KEGG   Chromobacterium violaceum: CV_0052Help
Entry
CV_0052           CDS       T00147                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
cvi  Chromobacterium violaceum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:cvi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CV_0052 (hemD)
Enzymes [BR:cvi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     CV_0052 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
LNCC_Brazil: 
UniProt: 
Position
complement(58518..59249)
Genome map
AA seq 243 aa AA seqDB search
MRRVLAARPLAQCAGLLEKLRAEGWQAGHLPLMEIEPLPEALAALPAQAARADALFWVSP
SAIDVGWPALAGMDFSGKRLACVGAASARRLADLSGRPVLHPTAGSDSEALLALPELADA
SGQRWLIVRGQGGRPLLADTLAARGAEVGVAEVYRRVDGAPDWAAFDAAPPDAVIITSGE
MVEQLFRLAGPRRTGALQCLLYCVPHPRIAERLAAFGAARIVTTRADDAALVAGLKEWFR
RHP
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgcgtcctcgccgcccgtccgctggcgcagtgcgccggcctgcttgagaagctg
cgggccgagggctggcaggccggacatctgcccttgatggaaatcgagcccttgccggag
gcgctggccgcgctgccggcgcaggcggcgcgggccgacgcgctgttctgggtcagcccc
agcgccatcgacgtcggctggccggcgctggcgggcatggatttcagcggcaagcggctg
gcctgcgtcggcgccgccagcgccagacggctggccgatctgtccggcagaccggtgctg
catcccaccgccggcagcgacagcgaggcgctgttggcgctgccggaactggccgacgcg
tccggccagcgctggttgatcgtccgcggccagggcggccgcccgctgctggcggacacg
ctggccgcgcgcggcgcggaagtgggcgtcgccgaggtctaccgccgcgtcgacggcgcg
ccggactgggccgccttcgacgccgctccgcccgatgccgtcatcatcacttcgggcgaa
atggtagagcaattgttccgactggctggtccgcgccggacgggggcgctacaatgcctg
ctatattgcgtgccgcatccgcgtatcgccgagcgcctggccgccttcggcgcggcacgc
atcgtgacaacccgggccgacgatgccgcactggtcgccggcctcaaagaatggttccgt
cgtcacccatga

DBGET integrated database retrieval system