KEGG   Chromobacterium violaceum: CV_0147Help
Entry
CV_0147           CDS       T00147                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
cvi  Chromobacterium violaceum
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cvi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CV_0147 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CV_0147 (glk)
   00052 Galactose metabolism
    CV_0147 (glk)
   00500 Starch and sucrose metabolism
    CV_0147 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    CV_0147 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CV_0147 (glk)
   00524 Butirosin and neomycin biosynthesis
    CV_0147 (glk)
Enzymes [BR:cvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CV_0147 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
LNCC_Brazil: 
UniProt: 
Position
160795..161808
Genome map
AA seq 337 aa AA seqDB search
MLGDVGGSNARFALETAPGVIEDILTLSNERYPTLEDALRDYLAQVGARRVAHAAIGIAN
PLNGDLVRMTNCHWSFSIEATRRALGLSTLLLLNDFTALALALPRLPRRELAQVGGGAPR
PDAPLALIGPGTGLGVSALVPHAGGWRALAGEGGHTSFAPANEREIGIWRYASARFGHVS
HERLLSGSGLSLLHRALCALDGAEEAGLAPAEVSARGLSGADARCREALEIFCALLGSAA
GNLALTLGARGGVYIGGGIVPRLSGFFEQSPFRRRFEDKGRMSAYLADIPVYLITSAYPA
LPGVAAHLADHLAPRSDPAPVAAPTHPRGGTAGDMHA
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
ctgctcggcgacgtcggcggcagcaacgcgcgcttcgcgctggaaaccgcgcccggggtg
attgaagacatcctgacgctgtccaatgagcgctacccgacgctggaggacgcgctgcgc
gactacctggcccaggtcggcgcgcgccgcgtcgcccacgccgccatcggcatcgccaat
ccgctgaacggcgacctggtgcggatgaccaattgccattggtcgttttccatcgaagcg
acgcgccgcgcgctgggcctctccacgctgctgctgctcaacgacttcaccgcgctggcg
ctggccctgcccaggctgccgcgccgggagctggcccaggtgggcggcggcgcgccgcgg
ccggacgcgccgctggcgctgatcggccccggcaccgggctgggcgtgtcggcgctggtg
ccgcacgccggcggctggcgcgcgctggccggcgagggcggccacacctcgttcgcgccg
gccaacgaacgcgaaatcggcatctggcgctacgcgtccgcccgcttcggccacgtgtcg
cacgagcggctgctgtccggctccggcctcagcctgctgcaccgggcgctgtgcgcgctg
gacggggcggaagaggccggcctggcgccggccgaagtcagcgcccgcggcctgtccggc
gccgacgcgcgctgccgcgaagcactggaaatcttctgcgcgctgctgggttcggcggcc
gggaatctggccttgaccctcggtgcccgtggcggggtgtacataggtggtggtattgtg
ccgcgtttgagcggtttttttgaacaatccccatttcgccgccgtttcgaggacaagggg
cggatgtcggcctatctggccgacatcccggtttacctgatcaccagcgcctacccggcc
ctgccgggcgtggccgcccatctggcggaccacctggcgccgcgcagcgacccggccccg
gtggcagcgcccacccatcctcgcggcggcacagcaggagacatgcatgcttga

DBGET integrated database retrieval system