KEGG   Chromobacterium violaceum: CV_0147Help
Entry
CV_0147           CDS       T00147                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
cvi  Chromobacterium violaceum
Pathway
cvi00010  Glycolysis / Gluconeogenesis
cvi00052  Galactose metabolism
cvi00500  Starch and sucrose metabolism
cvi00520  Amino sugar and nucleotide sugar metabolism
cvi00521  Streptomycin biosynthesis
cvi01100  Metabolic pathways
cvi01110  Biosynthesis of secondary metabolites
cvi01120  Microbial metabolism in diverse environments
cvi01130  Biosynthesis of antibiotics
cvi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cvi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CV_0147 (glk)
   00052 Galactose metabolism
    CV_0147 (glk)
   00500 Starch and sucrose metabolism
    CV_0147 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    CV_0147 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CV_0147 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    CV_0147 (glk)
Enzymes [BR:cvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CV_0147 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: AAQ57826
LNCC_Brazil: CV0147
UniProt: Q7P1R6
Position
160795..161808
Genome map
AA seq 337 aa AA seqDB search
MLGDVGGSNARFALETAPGVIEDILTLSNERYPTLEDALRDYLAQVGARRVAHAAIGIAN
PLNGDLVRMTNCHWSFSIEATRRALGLSTLLLLNDFTALALALPRLPRRELAQVGGGAPR
PDAPLALIGPGTGLGVSALVPHAGGWRALAGEGGHTSFAPANEREIGIWRYASARFGHVS
HERLLSGSGLSLLHRALCALDGAEEAGLAPAEVSARGLSGADARCREALEIFCALLGSAA
GNLALTLGARGGVYIGGGIVPRLSGFFEQSPFRRRFEDKGRMSAYLADIPVYLITSAYPA
LPGVAAHLADHLAPRSDPAPVAAPTHPRGGTAGDMHA
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
ctgctcggcgacgtcggcggcagcaacgcgcgcttcgcgctggaaaccgcgcccggggtg
attgaagacatcctgacgctgtccaatgagcgctacccgacgctggaggacgcgctgcgc
gactacctggcccaggtcggcgcgcgccgcgtcgcccacgccgccatcggcatcgccaat
ccgctgaacggcgacctggtgcggatgaccaattgccattggtcgttttccatcgaagcg
acgcgccgcgcgctgggcctctccacgctgctgctgctcaacgacttcaccgcgctggcg
ctggccctgcccaggctgccgcgccgggagctggcccaggtgggcggcggcgcgccgcgg
ccggacgcgccgctggcgctgatcggccccggcaccgggctgggcgtgtcggcgctggtg
ccgcacgccggcggctggcgcgcgctggccggcgagggcggccacacctcgttcgcgccg
gccaacgaacgcgaaatcggcatctggcgctacgcgtccgcccgcttcggccacgtgtcg
cacgagcggctgctgtccggctccggcctcagcctgctgcaccgggcgctgtgcgcgctg
gacggggcggaagaggccggcctggcgccggccgaagtcagcgcccgcggcctgtccggc
gccgacgcgcgctgccgcgaagcactggaaatcttctgcgcgctgctgggttcggcggcc
gggaatctggccttgaccctcggtgcccgtggcggggtgtacataggtggtggtattgtg
ccgcgtttgagcggtttttttgaacaatccccatttcgccgccgtttcgaggacaagggg
cggatgtcggcctatctggccgacatcccggtttacctgatcaccagcgcctacccggcc
ctgccgggcgtggccgcccatctggcggaccacctggcgccgcgcagcgacccggccccg
gtggcagcgcccacccatcctcgcggcggcacagcaggagacatgcatgcttga

DBGET integrated database retrieval system