KEGG   Chromobacterium violaceum: CV_0234Help
Entry
CV_0234           CDS       T00147                                 

Gene name
pcm2
Definition
(GenBank) protein-L-isoaspartate(D-aspartate) O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
cvi  Chromobacterium violaceum
Brite
Enzymes [BR:cvi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     CV_0234 (pcm2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT RrnaAD Methyltransf_31 Methyltransf_25 Methyltransf_11 MTS Methyltransf_12 Methyltransf_23 PrmA Methyltransf_18 CMAS NodS MetW Methyltransf_24 Methyltransf_4 tRNA_U5-meth_tr Methyltransf_32 Methyltransf_3 DUF3419 Ubie_methyltran Methyltr_RsmB-F Met_10 TrmK PPS_PS Methyltransf_15
Motif
Other DBs
NCBI-ProteinID: AAQ57913
LNCC_Brazil: CV0234
UniProt: Q7P1H9
Position
complement(242272..242931)
Genome map
AA seq 219 aa AA seqDB search
MDFEKTRFNMVEQQIRPWDVLDTNVLDLLFHVKREDFVADNQRQLAFVDTELPLPNGSKM
LQPKMEARLVQDAAIQPSDKILEIGTGSGYLTALLAKMGKQVVSVEIDPAQKALAAANLK
KAGIANVTLVEGDGVLGLAEQAPYDVIVVGGSLPVVPQELKNQLAVGGRLILVAGDLPVM
ACKLIERETNTSFRETALFETCVERLKKFEAVEPARFSF
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atggatttcgaaaaaacccgtttcaacatggtcgaacagcagattcgcccgtgggatgtt
ctggataccaacgtgctggatctgctgtttcacgtgaaacgcgaggacttcgtcgccgac
aatcagcgccagctggccttcgtcgacaccgagctgccgctgcccaacggcagcaagatg
ctgcagccgaagatggaagcgcgcctggtgcaggacgccgccatccagccgagcgacaag
atcctggagatcggcaccggcagcggctatctgaccgcgctgctggccaagatgggcaag
caggtggtgagcgtggagatcgatccggcgcaaaaagcgcttgccgccgccaatctgaag
aaggccggcatcgccaacgtcaccctggtcgagggcgacggcgtgctgggcctggccgag
caagcgccttacgacgtgatcgtggtcggcggctcgctgccggtcgtgccgcaggaactg
aagaaccagctggctgtcggcggccgcctgatcctggtggccggcgatctgccggtgatg
gcctgcaagctgatcgagcgcgagaccaacaccagcttccgcgaaaccgcgctgttcgaa
acctgtgtcgagcggctgaagaaattcgaggcggtggaacccgcccgtttcagcttctga

DBGET integrated database retrieval system