KEGG   Chromobacterium violaceum: CV_0318Help
Entry
CV_0318           CDS       T00147                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
cvi  Chromobacterium violaceum
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cvi00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
LNCC_Brazil: 
UniProt: 
Position
complement(336174..337025)
Genome map
AA seq 283 aa AA seqDB search
MSLPQGMSLATLAPGVDQILLAGDRFSARIALLGGQLIDYRRDGEPPLLYLSPQTTYQPG
KAIRGGVPVCWPWFGPHPSDAGLPAHGVARQQVWRLSDAGRDGDVFHVKLDGPRHGGLAA
ELDFRIGPDGVEIALTTANLGDAAQTVGAALHSYFAVSGIDKVDLLGLESAPAHDKVADQ
RVNLPALPLRFDGETDLIAYRGGLVTLRDAGWRRDIRIESAGSHSAVVWNPAQDKAQRLA
DLPDGDWRRFVCVETANAGDDARALAPGARHRLACRLHFSCHD
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgtcccttccccaaggcatgagcctcgccacgctggcgcccggcgtcgaccagatcctg
ctggccggcgaccgcttttccgcccgcatcgccctgctgggcggccagttgatcgactac
cgccgcgacggggagccgccgctgctctacctatcgccgcaaaccacctaccagcccggc
aaggcgatacgcggcggcgtgccggtatgctggccgtggttcggcccgcacccctccgat
gccggcttgccggcgcacggcgtcgcgcgacagcaagtctggcggctgagcgacgccggc
cgcgacggcgacgtgttccacgtgaaactggacggaccccgccacggcggactggccgcc
gagctggatttccgcatcggccccgatggcgtggaaatcgcgctgaccaccgccaatctt
ggcgacgccgcgcaaaccgtcggcgccgcgctgcacagctatttcgcggtatccggcatc
gacaaggtcgatctgctgggtctggagagcgcgccggcgcacgacaaggtggcggaccag
cgcgtgaacctgccggccctgcccttgcgcttcgacggcgagaccgacctgatcgcctac
cgcggcggcctggtcacgctgcgcgacgccggctggcggcgcgacatccggatcgaaagc
gccggctcgcacagcgcggtggtgtggaaccccgctcaggacaaggcgcaaaggctggca
gacctgcccgacggcgactggcggcgcttcgtctgcgtggaaaccgccaacgccggcgac
gacgcccgcgcgctggcgcccggcgcacgccaccggctggcttgcaggctgcatttctct
tgtcacgactag

DBGET integrated database retrieval system