KEGG   Chromobacterium violaceum: CV_0369Help
Entry
CV_0369           CDS       T00147                                 

Gene name
pyrB
Definition
(GenBank) aspartate carbamoyltransferase catalytic chain
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
cvi  Chromobacterium violaceum
Pathway
cvi00240  Pyrimidine metabolism
cvi00250  Alanine, aspartate and glutamate metabolism
cvi01100  Metabolic pathways
Module
cvi_M00051  Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:cvi00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    CV_0369 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CV_0369 (pyrB)
Enzymes [BR:cvi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     CV_0369 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: AAQ58047
LNCC_Brazil: CV0369
UniProt: Q7P145
Position
386113..387021
Genome map
AA seq 302 aa AA seqDB search
MYRKHIISIPDFSREELELVVDTAARLKQSPRGDLLQDKLVASCFFEPSTRTRLSFETAV
QRLGGNIIGFADGGNTSAKKGETLADSIKIISSYTDAVVMRHPKEGAARLASEFSAVPVI
NGGDGSNQHPTQTLLDLFSIRETQGRLDGLTVAFAGDLKYGRTVHSLAQALSLFGARFYF
VSPEVLAMPDYICEELDEKGISYTVADSLEAVIPEVDVLYMTRVQRERFDEAEFRKIQGQ
YALRADMLKHARPGMKVLHPLPRVDEIAVDVDATPHAYYFEQAKNGVYARQALLSLVLNE
TV
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
ctgtaccggaaacacatcatctccatacccgacttcagccgcgaggaactggaactggtg
gtggacaccgccgctcgcctcaagcaaagcccgcgcggcgacctgctgcaggacaagctg
gtggccagctgtttcttcgagccgtccacccgcacccggctgtcgttcgagaccgcggtg
cagcgcctgggcggcaacatcatcggcttcgccgacggcggcaataccagcgcgaagaaa
ggcgagacgctggccgactcgatcaagatcatcagttcctacaccgacgcggtggtgatg
cgccatccgaaggaaggcgcggcccggctggccagcgagttttcggcggtgccggtgatc
aacggcggcgacggctccaaccagcacccgacccagaccctgctcgatctgttctccatc
cgcgagacccagggccggctggacggcctcaccgtcgccttcgccggcgacctgaagtac
ggccgcaccgtgcattcgctggcgcaggcgctgtcgctgttcggcgcgcgcttctacttc
gtgtcgccggaggtgctggcgatgccggactacatctgcgaggagctggacgagaagggc
atttcgtacacggtggcggacagcctggaagcggtgatccccgaggtggacgtgctgtac
atgacccgggtgcagcgcgagcgcttcgacgaggcggagttcaggaagatccagggccag
tacgcgctgcgcgccgacatgctgaagcacgcccgccccggcatgaaggtgctgcacccg
ctgccgcgcgtggacgagatcgcggtggacgtggacgccaccccgcacgcctactacttc
gagcaggcgaagaacggcgtctacgcgcgccaggcgctgctgtcgctggtgttgaacgaa
accgtgtaa

DBGET integrated database retrieval system