KEGG   Chromobacterium violaceum: CV_0490Help
Entry
CV_0490           CDS       T00147                                 

Gene name
speB
Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
cvi  Chromobacterium violaceum
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cvi00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    CV_0490 (speB)
Enzymes [BR:cvi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     CV_0490 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
LNCC_Brazil: 
UniProt: 
Position
518577..519545
Genome map
AA seq 322 aa AA seqDB search
MSDEMIYGDGAIRRQGLYGSSIENTYAGVLSFMRRNYSRDLEGVDVAVSGIPLDLSVTFR
SGARMGPQAIRAASVQLAELKPYPWGFDPFEDLAVVDYGDCWFDAHNPLTIKPSIIEHAR
TILASGAKMLTFGGDHYVTYPLLIAHAEKYGKPLALLHFDAHCDTWPDDSPDSLNHGTMF
YKAVKEGLIDPKKSVQVGIRTWNDDFMGLNVLGAPWVHDNGVDATIAEIKKTIGDAPVYV
TFDIDCLDPSAAPGTGTPVPGGLTTAQALKIIRNLGDLNIVGMDVVEVAPSYDQSEITAI
AAAHIACDMLCLMRNKKVAGTL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatgaaatgatctacggcgacggcgccatccgccgtcagggcctgtacggctcc
tccatcgaaaacacctacgccggcgtgctgtccttcatgcgccgcaactacagccgcgac
ctggaaggcgtggacgtggcggtgtctggcattccgctggacctgtcggtcaccttccgt
tccggcgcgcgcatgggtccgcaggccatccgcgccgccagcgtgcagctggccgagctc
aagccctacccgtggggcttcgatccgttcgaagacctggccgtggtcgactacggcgac
tgctggttcgacgcccacaacccgctgaccatcaagccgtccatcatcgagcacgcccgc
actatcctggcctccggcgccaagatgctgaccttcggcggcgaccactacgtcacctac
ccgctcctgatcgcgcacgccgaaaaatacggcaagccgctggcgctgctgcacttcgac
gcgcactgcgacacttggccggacgacagcccggacagcctgaaccacggcaccatgttc
tacaaggcggtgaaggaaggcctgatcgatccgaagaaatcggtgcaggtcggcatccgc
acctggaacgacgacttcatgggcctgaacgtgctgggcgcgccctgggtgcacgataac
ggcgtggacgccaccatcgccgagatcaagaagaccatcggcgacgcgccggtctacgtg
accttcgacatcgactgtctggacccgtccgcggcgccgggcaccggcaccccggtgccg
ggcggcctgaccaccgcgcaggcgctgaagatcatccgcaacctgggcgatctgaacatc
gtcggcatggacgtggtggaagtggcgcccagctacgaccagagcgagatcaccgcgatc
gccgccgcccacatcgcctgtgacatgctgtgcctgatgcgcaacaagaaggtggcgggc
acgctgtaa

DBGET integrated database retrieval system