KEGG   Chromobacterium violaceum: CV_0611Help
Entry
CV_0611           CDS       T00147                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
cvi  Chromobacterium violaceum
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cvi01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:cvi00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
LNCC_Brazil: 
UniProt: 
Position
646476..647780
Genome map
AA seq 434 aa AA seqDB search
MLKLSSSQPDFAERLKALLAFETAQDPAVDAAVASICADVHHRGDAALVEHTNRFDRMQA
AGMADLTLSREQLEAAWLRLPADVRDALSAAAERVRRYHEKQLAHSWSYEDEDGTLLGQQ
VTPLDRVGIYVPGGKAAYPSSVLMNALPAKVAGVGEIIMVVPTPGGERNDLVLAAAYIAG
VDKVFTVGGAQAVAALAYGTETVPQVDKITGPGNAYVAAAKRRVFGVVGIDMVAGPSEIL
VICDGATDPDWVAMDLFSQAEHDEIAQAILLCPSADYIAQVEASIAKLLPSMPRRAIIEA
SLAGRGALIQVSDLAEACEISNYIAPEHLELSVADPDALLPQLRHAGAIFMGRFTSESLG
DYCAGPNHVLPTSRTARFASPLGVYDFQKRSSLIRVSQAGAQKLGRIASLLAHGEGLTAH
ARAAELRLEDGTPR
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaactgtcctcctcccagcccgacttcgccgagcgcctgaaagcgctgctggcc
ttcgaaaccgcgcaggaccccgcagtcgacgccgccgtggcgtccatctgcgccgacgtc
catcatcgcggcgacgcggcgctggtggagcacaccaaccgtttcgaccgcatgcaggcg
gccggcatggccgatctgacgctgagccgcgagcagctggaagcggcgtggctgcgtctg
ccggccgacgtgcgcgacgcgctgtccgccgccgccgagcgcgtgcgccgctaccacgag
aagcagctggcgcattcctggagctacgaggacgaggacggcaccttgctgggccagcag
gtgacgccgctggaccgcgtcggcatctacgtgccgggcggcaaggccgcctatccgagc
tcggtgctgatgaacgcgctcccagccaaagtggcaggcgtcggcgaaatcatcatggtg
gtgccgacgccgggcggcgagcgcaacgacctggtgctggccgcggcctacatcgccggc
gtcgacaaggtgtttaccgtcggtggcgcccaagccgtcgccgcgctggcctacggcacc
gagacggtgccgcaggtggacaagatcaccggccccggcaacgcctacgtcgccgccgcc
aagcgccgcgtgttcggcgtggtcggcatcgacatggtggccggcccgtccgagatcctg
gtgatctgcgacggcgccaccgatccggactgggtggcgatggacctgttcagccaggcc
gaacacgacgagatcgcccaggccatcctgctgtgcccgtcggcggattacatcgcgcag
gtggaagccagcatcgccaagctgctgccgtccatgccgcgccgcgccatcatcgaagcc
agcctggcgggccgcggcgcgctgatccaggtcagcgatctggcggaagcttgcgagatc
agcaattacatcgcgccggagcacctggagttgtcggtggccgatccggacgcgctgctg
ccgcaactgcgccacgccggcgccatcttcatgggccgcttcacctcggaaagcctgggc
gactactgcgccggccccaaccacgtgctgccgaccagccgcaccgcgcgcttcgccagc
ccgctgggcgtctacgacttccagaagcgcagcagcctgatccgggtgtcgcaggccggc
gcgcagaagctgggccgcatcgccagcctgctggcgcacggcgagggcctgaccgcccac
gcccgcgccgccgagctgcggctggaggacgggacgccgcgctag

DBGET integrated database retrieval system