KEGG   Chromobacterium violaceum: CV_0690Help
Entry
CV_0690           CDS       T00147                                 

Gene name
hpnA
Definition
dihydrokaempferol 4-reductase (EC:1.1.1.219)
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
cvi  Chromobacterium violaceum
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
LNCC_Brazil: 
UniProt: 
Position
complement(715630..716712)
Genome map
AA seq 360 aa AA seqDB search
MTQEKIAFVTGATGLLGNNLVRLLLAEGYRVRALARSERKAMEQFGELTGSRLEVVLGDL
TDVKGFAPALRGCQVIFHAAAYFRESYKGGRHLDALRKTNVEGTQNLLREAYTAGIRRMV
HISSIAVLGRNDSGLTDESMVLAIEEAPDDYYRSKIETDAVIFAFLDNHPDMHISLVLPG
WMHGPGDLGPTSAGQFVEDYLQQKIPGVIDAAFSVVDARDVAQVALASSQTGERGERYLA
AGHPVSMAGLLQAMEAVSGVPAPRRGLPRALLYAIASLQEIYARLTGKPVLLSLATVKNM
ANDYGRKFSSEKIRTRFGLGFRPMEETLAEEVAWIRQRMARAGMRQSGKENIGFANGGRR
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaagaaaaaatcgcatttgtcactggcgctaccggattgctgggcaataatctc
gttcgtttgctgctcgccgaaggttatcgggtcagggctttagccaggtcggaacggaaa
gccatggagcagttcggggagttgacaggcagccgtctagaagtggttctgggcgatctc
acggatgtaaaaggctttgctccagcattgcggggctgccaagttattttccatgccgcg
gcctacttccgcgaaagctacaaaggcggccgccatctggacgccctgcgcaagacgaat
gtcgaaggcacgcaaaatctgctgcgcgaggcgtacacggccggcattcggcgcatggtc
cacatcagctccatcgcggttttgggccgcaatgactctggattgaccgacgaaagcatg
gtgctggcaatagaggaggcaccggatgactattaccgcagcaagattgaaaccgacgcg
gtgatattcgctttcctcgacaaccacccggacatgcacatttccctggtcttgcccggc
tggatgcatggcccaggcgatcttgggccgacttcggccgggcagttcgtagaggactac
ttgcaacaaaaaattccaggcgtgatcgatgccgctttttctgtggtggatgcccgggat
gtggcccaagtcgctttggcatccagccaaacgggggaacgaggcgaacgctatttggcc
gcaggccaccccgtcagcatggccgggcttttacaggcgatggaagccgtaagcggtgtg
cccgccccgcgccgcggactgcctcgcgcactattgtatgccatcgcttctctgcaggag
atctatgctcgactgaccggcaagccggtattgctcagcttggccacggtaaaaaacatg
gctaacgactacggaagaaaattctcgtcggaaaaaatccggacccgctttggcctgggc
ttcaggcccatggaagaaacgctggcggaggaagtcgcgtggatccggcagcgaatggcg
cgagcggggatgcgccaatccggcaaagaaaacatcgggttcgccaatgggggcaggcga
taa

DBGET integrated database retrieval system