KEGG   Chromobacterium violaceum: CV_0727Help
Entry
CV_0727           CDS       T00147                                 

Definition
phage-related lysozyme (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
cvi  Chromobacterium violaceum
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
LNCC_Brazil: 
UniProt: 
Position
complement(750657..751097)
Genome map
AA seq 146 aa AA seqDB search
MKTNAAGISLIKQFEGVRLAAYQDMVGVWTIGYGHTGPDVKAGMTITQQQADQLLAADLE
KFETGVRKAVIVPLNANQFSALVSFSYNLGLGNLRSSTLLRLLNKGDYDGAAAQFPRWNR
AGGQAVPGLTRRRKAEQALFLTPAPC
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccaacgcagcaggcatcagcctgatcaagcaattcgagggcgtccgcctcgcc
gcctaccaggacatggtgggtgtctggaccataggctacggccacaccgggccggacgtg
aaagccggcatgacgatcacccagcaacaggcggaccagttgctggccgccgatctggag
aaattcgaaaccggcgtccgcaaagccgtgatcgtgccgctgaacgccaaccagttctcc
gccttggtcagcttcagctacaacctggggctgggaaacctccgcagctccacgctgctg
cgcctgttgaacaagggcgattacgacggcgccgccgcgcagttcccgcgctggaaccgg
gccggcggccaggccgtgcccggactgactcgccgccgcaaagccgagcaggcgctgttc
ctgacgcctgccccctgctga

DBGET integrated database retrieval system