KEGG   Chromobacterium violaceum: CV_0759Help
Entry
CV_0759           CDS       T00147                                 

Definition
(GenBank) probable carboxylesterase
  KO
K03928  carboxylesterase [EC:3.1.1.1]
Organism
cvi  Chromobacterium violaceum
Brite
Enzymes [BR:cvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     CV_0759
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 Peptidase_S9 Thioesterase DLH Abhydrolase_3 PhoPQ_related
Motif
Other DBs
NCBI-ProteinID: AAQ58435
LNCC_Brazil: CV0759
UniProt: Q7P010
Position
complement(778526..779344)
Genome map
AA seq 272 aa AA seqDB search
MVSTRPAALLVHGLGGTAYDLGALGRTLEDADIVTHSPVLPGHGGSPEDLLGVGWEDWVE
SIRSEYRALKAKHKVVHLAGVCLGGLVALEVARREKHQDKLALYAPPVFLDGWSLPKLTW
LRHAVYHIPRLAKKMRVPEVSPFGIKNARIRKAIQQRFERGDRFHYAYIPLMCIREVDRL
RRQLLPRLAEITCPTLIVHADEDDITSPRSAHHLMQYLGGPVDFMPLSNSYHMVMVDNER
AEVLQRSLKFFNSAPQPQLVEQACGWTAFAAA
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggtttccacacgaccggcggcgctgctggtacacggccttggcggtaccgcttatgat
ctgggcgcgctgggccgcacgctggaagacgccgacatcgttacccactccccggtgctg
cccggtcacggcggctcgccggaagacctgctgggcgtaggctgggaagattgggtggaa
agcattcgcagcgaataccgcgcactgaaggccaagcacaaggtcgtccacctggcaggc
gtctgcctgggcggcctggtggcgctggaagtggcacgccgcgagaagcatcaggacaag
ctggcgctgtacgcgccgccggtgttcctcgacggctggagcctgcccaagctgacctgg
ctgcgccacgcggtgtatcacatcccccggctggccaagaaaatgcgcgtgccggaagtc
tccccgttcggcatcaagaacgcgcgcatccgcaaggcgatccaacagcgcttcgagcgc
ggcgaccgcttccattacgcctacatcccgctgatgtgcatccgcgaagtggaccgcctg
cgccgccagctgctgccgcgcctggccgagatcacctgtccgacgctgatcgtccacgcc
gacgaagacgacatcaccagcccgcgctccgcccaccacctgatgcagtacctgggcggc
ccggtggacttcatgccgctgtccaacagctaccacatggtcatggtcgacaacgagcgc
gccgaggtgctgcagcgcagcttgaagttcttcaacagcgcgccccagccccagttggtc
gaacaggcctgcggctggaccgccttcgcggccgcctga

DBGET integrated database retrieval system