KEGG   Chromobacterium violaceum: CV_0759Help
Entry
CV_0759           CDS       T00147                                 

Definition
carboxylesterase (EC:3.1.1.1)
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
cvi  Chromobacterium violaceum
Brite
Enzymes [BR:cvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     CV_0759
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
LNCC_Brazil: 
UniProt: 
Position
complement(778526..779344)
Genome map
AA seq 272 aa AA seqDB search
MVSTRPAALLVHGLGGTAYDLGALGRTLEDADIVTHSPVLPGHGGSPEDLLGVGWEDWVE
SIRSEYRALKAKHKVVHLAGVCLGGLVALEVARREKHQDKLALYAPPVFLDGWSLPKLTW
LRHAVYHIPRLAKKMRVPEVSPFGIKNARIRKAIQQRFERGDRFHYAYIPLMCIREVDRL
RRQLLPRLAEITCPTLIVHADEDDITSPRSAHHLMQYLGGPVDFMPLSNSYHMVMVDNER
AEVLQRSLKFFNSAPQPQLVEQACGWTAFAAA
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggtttccacacgaccggcggcgctgctggtacacggccttggcggtaccgcttatgat
ctgggcgcgctgggccgcacgctggaagacgccgacatcgttacccactccccggtgctg
cccggtcacggcggctcgccggaagacctgctgggcgtaggctgggaagattgggtggaa
agcattcgcagcgaataccgcgcactgaaggccaagcacaaggtcgtccacctggcaggc
gtctgcctgggcggcctggtggcgctggaagtggcacgccgcgagaagcatcaggacaag
ctggcgctgtacgcgccgccggtgttcctcgacggctggagcctgcccaagctgacctgg
ctgcgccacgcggtgtatcacatcccccggctggccaagaaaatgcgcgtgccggaagtc
tccccgttcggcatcaagaacgcgcgcatccgcaaggcgatccaacagcgcttcgagcgc
ggcgaccgcttccattacgcctacatcccgctgatgtgcatccgcgaagtggaccgcctg
cgccgccagctgctgccgcgcctggccgagatcacctgtccgacgctgatcgtccacgcc
gacgaagacgacatcaccagcccgcgctccgcccaccacctgatgcagtacctgggcggc
ccggtggacttcatgccgctgtccaacagctaccacatggtcatggtcgacaacgagcgc
gccgaggtgctgcagcgcagcttgaagttcttcaacagcgcgccccagccccagttggtc
gaacaggcctgcggctggaccgccttcgcggccgcctga

DBGET integrated database retrieval system