KEGG   Chromobacterium violaceum: CV_0808Help
Entry
CV_0808           CDS       T00147                                 

Definition
zinc-containing alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
cvi  Chromobacterium violaceum
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cvi00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    CV_0808
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CV_0808
  Lipid metabolism
   00071 Fatty acid degradation
    CV_0808
  Amino acid metabolism
   00350 Tyrosine metabolism
    CV_0808
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CV_0808
   00626 Naphthalene degradation
    CV_0808
Enzymes [BR:cvi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CV_0808
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
LNCC_Brazil: 
UniProt: 
Position
complement(833053..834045)
Genome map
AA seq 330 aa AA seqDB search
MKSLEIHLIRRPTGMPSADLFALEEVALPKLQTGQALIENLYLSVDPYMRECMDLEEEWP
LHTPLEGRSIGRVIDAGSSGLNVGELVFHREGWRSHAAVAAEELRVLKEYPGVSASAFLS
IMGGTGLTAYVALSRIAKLQAGEDIFVSAAAGGVGSAIAQLARLMGAGRLIGSTGSAAKA
RYLTETLDYDFAIDYHSQDLSQALGEAAPEGFDIYIDNVGGKHQEAAIRHIRDHGRIAWV
GAVGQYNHAESPELARNLYDIVGKSLRLEGFLVRNYRHLQDELEAFVVPHLQSGRLQPQQ
TVREGLENMAQAFVDMLAGANLGKMLIKLA
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaagagtttggaaatccatctgatccgccgcccgactggcatgcccagcgccgatcta
ttcgcgctcgaagaagtggcgctccccaagctgcaaaccggccaggcgcttattgaaaac
ctgtacttatccgtcgacccctatatgcgggaatgcatggatttggaagaggaatggcca
ttgcacacgccgctggaaggccgcagcataggccgcgtcatcgatgccggcagcagcggt
ttgaatgtgggggagctggttttccatcgcgaaggttggcgtagccatgcggcggtggcg
gcggaggagctgcgggtactgaaagaataccccggcgtctccgccagcgccttcctgagc
atcatggggggcaccggactgaccgcctatgtggcgcttagccgcatcgccaagctgcag
gccggcgaagatatcttcgtctcggcggccgctggcggcgtcggaagcgcgatcgcgcag
ttggccaggctgatgggggccggccgcctgatcggcagcaccggctctgccgccaaggcc
cgctacctgacggaaacgctggactatgattttgccattgactaccacagccaagacctg
tcccaggccctgggcgaggccgctccggaaggattcgacatctatatcgataatgtcggc
ggcaagcaccaggaggcggcgatccggcatatccgcgatcatggccgcatcgcctgggta
ggcgcggtgggccaatataaccatgcggagtcgcccgaactggcgcgcaatctctacgac
atcgtggggaaaagcctgcggctggagggttttttggtgcgcaactaccgccacctgcaa
gacgaattggaggcttttgtcgttccccatctgcagtcgggccggctgcagccgcaacag
accgttagagaagggctggagaatatggcgcaagccttcgtcgacatgctggccggggcc
aatctgggcaagatgctgatcaagctcgcctaa

DBGET integrated database retrieval system