KEGG   Chromobacterium violaceum: CV_0808Help
Entry
CV_0808           CDS       T00147                                 

Definition
(GenBank) probable zinc-containing alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
cvi  Chromobacterium violaceum
Pathway
cvi00010  Glycolysis / Gluconeogenesis
cvi00071  Fatty acid degradation
cvi00350  Tyrosine metabolism
cvi00625  Chloroalkane and chloroalkene degradation
cvi00626  Naphthalene degradation
cvi01100  Metabolic pathways
cvi01110  Biosynthesis of secondary metabolites
cvi01120  Microbial metabolism in diverse environments
cvi01130  Biosynthesis of antibiotics
cvi01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cvi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CV_0808
  Lipid metabolism
   00071 Fatty acid degradation
    CV_0808
  Amino acid metabolism
   00350 Tyrosine metabolism
    CV_0808
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CV_0808
   00626 Naphthalene degradation
    CV_0808
Enzymes [BR:cvi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CV_0808
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N_2 ADH_zinc_N ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: AAQ58484
LNCC_Brazil: CV0808
UniProt: Q7NZW1
Position
complement(833053..834045)
Genome map
AA seq 330 aa AA seqDB search
MKSLEIHLIRRPTGMPSADLFALEEVALPKLQTGQALIENLYLSVDPYMRECMDLEEEWP
LHTPLEGRSIGRVIDAGSSGLNVGELVFHREGWRSHAAVAAEELRVLKEYPGVSASAFLS
IMGGTGLTAYVALSRIAKLQAGEDIFVSAAAGGVGSAIAQLARLMGAGRLIGSTGSAAKA
RYLTETLDYDFAIDYHSQDLSQALGEAAPEGFDIYIDNVGGKHQEAAIRHIRDHGRIAWV
GAVGQYNHAESPELARNLYDIVGKSLRLEGFLVRNYRHLQDELEAFVVPHLQSGRLQPQQ
TVREGLENMAQAFVDMLAGANLGKMLIKLA
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaagagtttggaaatccatctgatccgccgcccgactggcatgcccagcgccgatcta
ttcgcgctcgaagaagtggcgctccccaagctgcaaaccggccaggcgcttattgaaaac
ctgtacttatccgtcgacccctatatgcgggaatgcatggatttggaagaggaatggcca
ttgcacacgccgctggaaggccgcagcataggccgcgtcatcgatgccggcagcagcggt
ttgaatgtgggggagctggttttccatcgcgaaggttggcgtagccatgcggcggtggcg
gcggaggagctgcgggtactgaaagaataccccggcgtctccgccagcgccttcctgagc
atcatggggggcaccggactgaccgcctatgtggcgcttagccgcatcgccaagctgcag
gccggcgaagatatcttcgtctcggcggccgctggcggcgtcggaagcgcgatcgcgcag
ttggccaggctgatgggggccggccgcctgatcggcagcaccggctctgccgccaaggcc
cgctacctgacggaaacgctggactatgattttgccattgactaccacagccaagacctg
tcccaggccctgggcgaggccgctccggaaggattcgacatctatatcgataatgtcggc
ggcaagcaccaggaggcggcgatccggcatatccgcgatcatggccgcatcgcctgggta
ggcgcggtgggccaatataaccatgcggagtcgcccgaactggcgcgcaatctctacgac
atcgtggggaaaagcctgcggctggagggttttttggtgcgcaactaccgccacctgcaa
gacgaattggaggcttttgtcgttccccatctgcagtcgggccggctgcagccgcaacag
accgttagagaagggctggagaatatggcgcaagccttcgtcgacatgctggccggggcc
aatctgggcaagatgctgatcaagctcgcctaa

DBGET integrated database retrieval system