KEGG   Chromobacterium violaceum: CV_0939Help
Entry
CV_0939           CDS       T00147                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cvi  Chromobacterium violaceum
Pathway
cvi00010  Glycolysis / Gluconeogenesis
cvi00051  Fructose and mannose metabolism
cvi00562  Inositol phosphate metabolism
cvi01100  Metabolic pathways
cvi01110  Biosynthesis of secondary metabolites
cvi01120  Microbial metabolism in diverse environments
cvi01130  Biosynthesis of antibiotics
cvi01200  Carbon metabolism
cvi01230  Biosynthesis of amino acids
Module
cvi_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cvi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CV_0939 (tpiA)
   00051 Fructose and mannose metabolism
    CV_0939 (tpiA)
   00562 Inositol phosphate metabolism
    CV_0939 (tpiA)
Enzymes [BR:cvi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CV_0939 (tpiA)
Exosome [BR:cvi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CV_0939 (tpiA)
  Exosomal proteins of bladder cancer cells
   CV_0939 (tpiA)
  Exosomal proteins of melanoma cells
   CV_0939 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM Glyco_hydro_3_C
Motif
Other DBs
NCBI-ProteinID: AAQ58613
LNCC_Brazil: CV0939
UniProt: Q7NZI3
Position
974488..975234
Genome map
AA seq 248 aa AA seqDB search
MSGKLVIGNWKMNTRGDSARQLAAALLADGQTNREGVGIAAPAVYLAALAEQLKGGKIAL
SSQDVSRFAADGAFTGEVSAAMLADVGCRYALVGHSERRQYFREDNAALLAKMRNAIAAG
VTPVLCVGETLAQREAGDYLNVVREQLAILSDIADGEYVVAYEPVWAIGTGKVASLEQIA
EIHAFIKNWCLQNAGGSAKIRVLYGGSVKAENAEAILATENVDGALVGGASLDADSFRVI
CQAAGKMI
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtccggcaaactggtgattggcaactggaagatgaacacccgcggcgacagcgcccga
cagctggcggcggccctgctggccgacgggcagaccaatcgcgagggcgtcggcatcgcc
gctcccgccgtctatctggcggcgctggccgagcagctgaagggcggcaaaatcgccttg
tcctcccaggacgtcagccgtttcgccgccgacggcgcgttcaccggcgaggtgagcgcc
gcgatgctggccgacgtcggctgccgctacgcgctggtcggccactccgagcgccgccag
tatttccgcgaggacaacgcggcgctgctggccaagatgcgcaacgccatcgccgccggc
gtgactccggtgctgtgcgtcggcgagacgctggcgcaacgggaggcgggcgattatctg
aacgtggtgcgggaacagcttgccatcctgtccgatatcgccgatggtgaatacgtcgtc
gcctacgaaccggtatgggccatcggcaccggcaaggtggcgtcgcttgagcagatcgcg
gagatccatgcattcatcaaaaattggtgcttgcaaaacgctggcggctccgctaagatt
cgcgtcctctacggcggcagtgtcaaagcagagaatgccgaagcgattctggcgacggaa
aacgtcgacggagcactggtcggaggagcctctctggacgccgattcattcagagtgatt
tgccaagccgcaggaaaaatgatatag

DBGET integrated database retrieval system