KEGG   Chromobacterium violaceum: CV_0939Help
Entry
CV_0939           CDS       T00147                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cvi  Chromobacterium violaceum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cvi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CV_0939 (tpiA)
   01230 Biosynthesis of amino acids
    CV_0939 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CV_0939 (tpiA)
   00051 Fructose and mannose metabolism
    CV_0939 (tpiA)
   00562 Inositol phosphate metabolism
    CV_0939 (tpiA)
Enzymes [BR:cvi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CV_0939 (tpiA)
Exosome [BR:cvi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CV_0939 (tpiA)
  Exosomal proteins of bladder cancer cells
   CV_0939 (tpiA)
  Exosomal proteins of melanoma cells
   CV_0939 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
LNCC_Brazil: 
UniProt: 
Position
974488..975234
Genome map
AA seq 248 aa AA seqDB search
MSGKLVIGNWKMNTRGDSARQLAAALLADGQTNREGVGIAAPAVYLAALAEQLKGGKIAL
SSQDVSRFAADGAFTGEVSAAMLADVGCRYALVGHSERRQYFREDNAALLAKMRNAIAAG
VTPVLCVGETLAQREAGDYLNVVREQLAILSDIADGEYVVAYEPVWAIGTGKVASLEQIA
EIHAFIKNWCLQNAGGSAKIRVLYGGSVKAENAEAILATENVDGALVGGASLDADSFRVI
CQAAGKMI
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtccggcaaactggtgattggcaactggaagatgaacacccgcggcgacagcgcccga
cagctggcggcggccctgctggccgacgggcagaccaatcgcgagggcgtcggcatcgcc
gctcccgccgtctatctggcggcgctggccgagcagctgaagggcggcaaaatcgccttg
tcctcccaggacgtcagccgtttcgccgccgacggcgcgttcaccggcgaggtgagcgcc
gcgatgctggccgacgtcggctgccgctacgcgctggtcggccactccgagcgccgccag
tatttccgcgaggacaacgcggcgctgctggccaagatgcgcaacgccatcgccgccggc
gtgactccggtgctgtgcgtcggcgagacgctggcgcaacgggaggcgggcgattatctg
aacgtggtgcgggaacagcttgccatcctgtccgatatcgccgatggtgaatacgtcgtc
gcctacgaaccggtatgggccatcggcaccggcaaggtggcgtcgcttgagcagatcgcg
gagatccatgcattcatcaaaaattggtgcttgcaaaacgctggcggctccgctaagatt
cgcgtcctctacggcggcagtgtcaaagcagagaatgccgaagcgattctggcgacggaa
aacgtcgacggagcactggtcggaggagcctctctggacgccgattcattcagagtgatt
tgccaagccgcaggaaaaatgatatag

DBGET integrated database retrieval system