KEGG   Chromobacterium violaceum: CV_0997Help
Entry
CV_0997           CDS       T00147                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cvi  Chromobacterium violaceum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cvi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CV_0997 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CV_0997 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CV_0997 (thrC)
Enzymes [BR:cvi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CV_0997 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
LNCC_Brazil: 
UniProt: 
Position
1035673..1037082
Genome map
AA seq 469 aa AA seqDB search
MRYISTRGGMAPLPFCETVLMGLAPDGGLLLPERYPRIDRATLDAWRQLGYAELAFEIIR
LFADDIPADDLKGIVARAYRAETFGSEAIAPIKRLHDGLAILELSNGPTLAFKDMAMQFL
GQLFEYVLEKRGETLNILGATSGDTGSAAEYAMRGKRGIQVFMLSPDGKMSAFQRAQMYS
LQDENIHNIAIQGMFDDCQDIVKAVQNDHAFKAKHKIGTVNSINWARVVAQVVYYFHGYF
RATASNDERVSFCVPSGNFGNVCAGHVARQMGLPIERLIVATNENDVLDEFFRTGRYAPR
GSERTYVTSSPSMDISKASNFERFVFDLVGRDGAEVKRLWAEVDAGGGFQLDADAMGRVR
DAFGFVSGKSAHADRIATIRQVDAEDGVVVDTHTADGIKAARELRREGETVVCLETALPA
KFAETIREALDRDPPRPAGFEALESLPQRVVTLPADAGKVKALIEKTLG
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgcgatatatcagtacccgcggcggcatggcgccgctgccgttttgcgaaaccgtgctg
atgggcctggcgccggacggcggcctgctgttgccggagcgctatcccaggatcgaccga
gccacgctggatgcctggcggcaactgggctacgccgagctggcgttcgagatcatccgc
ctgttcgccgacgacatcccggcggacgacctgaaaggcatcgtcgcgcgggcctaccgc
gcggaaaccttcggcagcgaggccatcgcgccgatcaagcgcctgcatgacggcctggcc
atcctggagctgtccaacggtccgacgctggcgttcaaggacatggcgatgcagttcctc
ggccagctgttcgaatacgtgctggagaagcgcggcgagacgttgaacatcctgggcgcc
acctccggcgacaccggttccgccgccgaatacgcgatgcgcggcaagcgcggcatccag
gtgttcatgctgagcccggacggcaagatgagcgccttccagcgcgcgcagatgtacagc
ctgcaggatgagaacatccacaacatcgccatccagggcatgttcgacgactgccaggac
atcgtgaaggcggtgcagaacgaccacgccttcaaggcgaagcataagatcggcacggtc
aattcgatcaactgggcccgggtcgtcgcccaggtggtgtactacttccacggctatttc
cgcgccacggcgagcaacgacgagagagtcagcttctgcgtgccgtccggcaacttcggc
aacgtctgcgccggccacgtggcgcgccagatgggcctgcccatcgagcgcctgatcgtc
gccaccaacgagaacgacgtgctggacgaattcttccgcaccggccgctacgcgccgcgc
ggcagcgagcgcacctatgtcacctccagcccgtcgatggacatctccaaggcctccaac
ttcgagcgcttcgttttcgatctggtcggccgcgacggggccgaggtcaagcggctgtgg
gccgaggtggacgccggcggcggcttccagctggatgctgacgccatgggccgggtgcgc
gacgcgtttggcttcgtgtccggcaagagcgcgcacgccgaccgcattgcgaccatccgc
caggtggacgctgaggacggcgtggtggtggacacccacaccgccgacggcatcaaggcg
gcgcgcgagctgcgccgcgaaggcgaaaccgtggtttgtctggaaaccgcgctgccggcc
aagttcgccgagaccatccgcgaggcgctggaccgcgatccgccgcggccggccggtttc
gaggcgctggaatcgctgccgcagcgggtggtgacgctgccggcggacgccggcaaggtg
aaggcgctgatcgagaagacgctgggctga

DBGET integrated database retrieval system