KEGG   Chromobacterium violaceum: CV_1028Help
Entry
CV_1028           CDS       T00147                                 

Gene name
folA
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
cvi  Chromobacterium violaceum
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cvi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CV_1028 (folA)
   00670 One carbon pool by folate
    CV_1028 (folA)
Enzymes [BR:cvi01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     CV_1028 (folA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
LNCC_Brazil: 
UniProt: 
Position
1073428..1073925
Genome map
AA seq 165 aa AA seqDB search
MSEAKKPTLTLVAAMAANRTIGVDNKLPWHLPEDLKHFKAATLGKPVIMGRKTWDSIGRP
LPGRRNIVVTRQAAWRADGAETAHSLQEALALAGAVEEACLIGGADLYRQAMALADRLCL
TEIARDYDGDAHFPAFAADEWREVSREQAVSAAGLPYAFVEYRRR
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagcgaaaaagccgacgctgacgctggtggccgcgatggccgccaaccgcacc
ataggcgtggacaacaagctgccctggcatctgccggaggacctcaagcacttcaaggcg
gccacgctgggcaagccggtgatcatgggccgcaagacctgggattcgatcggccggccg
ctgccgggccgccgcaacatcgtggtgacccgccaggccgcttggcgcgcggacggcgcg
gaaaccgcgcattcgctgcaggaggcgctggcgctggccggcgcggtggaggaggcctgc
ctgatcggcggcgccgatctgtaccgccaggccatggcgctggccgaccgcctgtgcctg
accgagatcgcccgcgactacgacggcgacgcccattttccggccttcgccgccgacgag
tggcgcgaggtttcgcgcgagcaggcggtcagcgcagcggggctgccctacgccttcgtc
gaataccgccgccgctga

DBGET integrated database retrieval system