KEGG   Chromobacterium violaceum: CV_1066Help
Entry
CV_1066           CDS       T00147                                 

Gene name
sdhD
Definition
succinate dehydrogenase, hydrophobic subunit (EC:1.3.99.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
cvi  Chromobacterium violaceum
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:cvi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CV_1066 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CV_1066 (sdhD)
   00650 Butanoate metabolism
    CV_1066 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    CV_1066 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
LNCC_Brazil: 
UniProt: 
Position
1112233..1112577
Genome map
AA seq 114 aa AA seqDB search
MVNRHVVGAGYGLRDWIMQRVTAVVMVLYTVALALFLLALPAGYEGWKSLFSHTWVQLFT
QVTLLALFLHVWVGIRDVWMDYVKPVGIRLALHVFTIVWLVSCFIYSVKVVWGL
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaccgtcatgtcgtcggcgccggctacggcctgcgcgattggatcatgcagcgc
gtcaccgccgtggtgatggtgctctacaccgtggccctggcgctgttcctgctggcgctg
ccggccggctacgaaggctggaagtctctgttcagccatacctgggtccagctgttcacc
caggtgaccttgctggcgctgttcctgcacgtatgggtgggcatccgcgacgtctggatg
gactacgtgaagccggtgggcatccgcctggccctgcacgtgttcaccatcgtctggctg
gtttcctgtttcatctattccgttaaagtggtctgggggctgtaa

DBGET integrated database retrieval system