KEGG   Chromobacterium violaceum: CV_1072Help
Entry
CV_1072           CDS       T00147                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoamide succinyltransferase E2 component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cvi  Chromobacterium violaceum
Pathway
cvi00020  Citrate cycle (TCA cycle)
cvi00310  Lysine degradation
cvi01100  Metabolic pathways
cvi01110  Biosynthesis of secondary metabolites
cvi01120  Microbial metabolism in diverse environments
cvi01130  Biosynthesis of antibiotics
cvi01200  Carbon metabolism
Module
cvi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cvi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cvi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CV_1072 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    CV_1072 (sucB)
Enzymes [BR:cvi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CV_1072 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: AAQ58747
LNCC_Brazil: CV1072
UniProt: Q7NZ50
Position
1119676..1120905
Genome map
AA seq 409 aa AA seqDB search
MLIEVKVPQLPESVSEARLMSWHKKVGEFVKRDENLIDLETDKVVLELPAPQAGVVVEII
EQDGATVTSGQLIAKIDTAAKAGDAAPAAAAAAPVQAAPAAGAAAMPSAAKLAAETGVDL
SKVAGSGRDGRVLKEDVQAAAKSAAPSQAGPVLAPASAGAALSATPAAVNVAGILSGRAE
QRVPMSRLRQRVAERLVMSQQTNAILTTFNEVNMKPVMDLRAKYKDRFEKEHGIKLGFMG
FFVKAVVAALKKYPIVNASVDGNDIVYHGYFDVGVAVGSPRGLVVPVIRNADQLSLAEIE
KQIADFGKRAQEGKLTVEELTGGTYTISNGGTFGSMMSTPIINPPQSAILGMHATKERAV
VENGQVVVRPMMYLAQSYDHRIIDGREAVLSLVAIKDAIEDPARLLLDL
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgctgattgaagtcaaagtcccgcaactgcccgagtccgtatccgaagccaggctgatg
agctggcacaagaaggtcggcgaattcgtcaagcgcgacgaaaacctgatcgacctggaa
accgacaaggtggtgctggaactgccggcgccgcaagccggcgtggtggtggaaatcatc
gagcaggacggcgccaccgtgacctccggccagctgatcgccaagatcgacaccgctgcc
aaggcgggcgacgccgctccggccgccgccgccgccgctccggttcaggccgctccggcc
gccggcgccgccgcgatgccgtccgccgccaagctggccgccgagaccggcgtcgacctg
tccaaggtggccggttccggccgcgacggccgcgtgctgaaggaagacgtgcaggccgcc
gccaagtcggccgcgccgtcccaggccggcccggtgctggccccggcttccgccggcgcc
gcgctgtccgccaccccggccgccgtcaacgtggccggcatcctgtccggccgcgccgag
cagcgcgtgccgatgtcccgcctgcgccagcgcgtggccgagcgcctggtgatgagccag
cagaccaacgccatcctcaccaccttcaacgaagtgaacatgaagccggtgatggacctg
cgcgccaagtacaaggaccgcttcgagaaagagcacggcatcaagctgggcttcatgggc
ttcttcgtcaaggccgtggtcgccgcgctgaagaagtacccgatcgtcaacgcgtccgtg
gacggcaacgacatcgtctaccacggctacttcgacgtgggcgtggcggtgggcagcccg
cgcggcctggtggtgccggtgatccgcaacgccgaccagctgagcctggccgagatcgag
aagcagatcgccgacttcggcaagcgcgcccaggaaggcaagctgaccgtggaagagctg
accggcggcacctacaccatctccaacggcggcaccttcggctcgatgatgtccaccccc
atcatcaacccgccgcagtccgcgatcctgggcatgcacgccaccaaggagcgcgccgtg
gttgagaacggtcaagtggtggtgcgtccgatgatgtatcttgcccagtcctacgaccac
cgcatcatcgacggtcgcgaggcggtgctgagcctggtggcgatcaaggacgccatcgag
gatccggcgcgtctgctgctcgacctgtga

DBGET integrated database retrieval system