KEGG   Chromobacterium violaceum: CV_1075Help
Entry
CV_1075           CDS       T00147                                 

Gene name
sucC
Definition
(RefSeq) succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
cvi  Chromobacterium violaceum
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cvi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CV_1075 (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CV_1075 (sucC)
   00640 Propanoate metabolism
    CV_1075 (sucC)
   00660 C5-Branched dibasic acid metabolism
    CV_1075 (sucC)
Enzymes [BR:cvi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     CV_1075 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
LNCC_Brazil: 
UniProt: 
Position
1122761..1123933
Genome map
AA seq 390 aa AA seqDB search
MNLHEYQAKELLSRYGLPVQQGILAKSPEEAAAAYDKLGGKFAVVKAQVHAGGRGKAGGV
KVVKSREEAAEVAKTLIGTNLVTYQTDAAGQPVNSVLVCEDMYPVQRELYLGAVVDRGSQ
RVVFMVSTEGGVEIEKVAEETPEKIIKIEVDPLVGMQPFQARDAAFALGLSGAQVAAFSK
LMLGSYQAFIENDFALFEVNPLALRENGELACVDGKINLDSNALYRHPELLAQRDKSQEN
EREVKASEFDLNYVALEGNIGCMVNGAGLAMATMDIIKLKGGQPANFLDVGGGATKERVI
EAFKLILADTSVQGVLINIFGGIVRCDMIAEAIIAAVKEVNVTVPVVVRLEGNNAELGAK
ILDESGLKLTSAQGLNDAAEKIVAAVKAVA
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaacctgcatgaataccaagcgaaagagctgctgagccgttacggcctgccggtgcaa
caaggcattctggccaagtcgccggaagaggcggctgccgcttacgacaagctgggcggc
aaattcgccgtcgtgaaggcccaggtgcacgccggcggccgcggcaaggcgggcggcgtg
aaggtggtgaagagccgcgaggaagccgcggaagtcgccaagaccctgatcggcaccaac
ctggtgacctaccagaccgacgccgccggccagccggtgaacagcgtgctggtttgcgaa
gacatgtacccggtgcagcgcgaactgtacctgggcgccgtggtggaccgcggcagccag
cgcgtcgtgttcatggtttccaccgaaggcggcgtggaaatcgagaaggtggctgaagag
accccggaaaagatcatcaagatcgaagtggacccgctggtcggcatgcagccgttccag
gcgcgcgacgccgctttcgcgctgggcctgtccggcgcgcaggtcgccgcgttcagcaag
ctgatgctgggctcctaccaggccttcatcgagaacgacttcgccctgttcgaagtgaac
ccgctggcgctgcgcgaaaacggcgagctggcttgcgtggacggcaagatcaacctggac
tccaacgccctgtaccgccacccggaactgctggcccagcgcgacaagagccaggagaac
gagcgcgaagtgaaggcttccgagttcgacctgaactacgtggccctggaaggcaatatc
ggctgcatggtgaacggcgccggcctggcgatggctaccatggacatcatcaagctgaag
ggcggccagccggccaacttcctggacgtgggcggcggcgcgaccaaagagcgcgtgatc
gaagcgttcaagctgatcctggccgacacctcggtgcaaggcgtgctgatcaacatcttc
ggcggcatcgtccgctgcgacatgatcgccgaagccatcatcgccgccgtgaaggaagtg
aacgtgaccgtgccggtcgtggtccgtctggaaggcaacaacgccgagctgggcgccaag
atcctggacgaatccggcctgaaactgacttccgcccagggtctgaacgacgctgccgag
aagatcgtcgccgccgtcaaggccgtggcctga

DBGET integrated database retrieval system