KEGG   Chromobacterium violaceum: CV_1075Help
Entry
CV_1075           CDS       T00147                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
cvi  Chromobacterium violaceum
Pathway
cvi00020  Citrate cycle (TCA cycle)
cvi00640  Propanoate metabolism
cvi00660  C5-Branched dibasic acid metabolism
cvi01100  Metabolic pathways
cvi01110  Biosynthesis of secondary metabolites
cvi01120  Microbial metabolism in diverse environments
cvi01130  Biosynthesis of antibiotics
cvi01200  Carbon metabolism
Module
cvi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cvi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cvi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CV_1075 (sucC)
   00640 Propanoate metabolism
    CV_1075 (sucC)
   00660 C5-Branched dibasic acid metabolism
    CV_1075 (sucC)
Enzymes [BR:cvi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     CV_1075 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AAQ58750
LNCC_Brazil: CV1075
UniProt: Q7NZ47
Position
1122761..1123933
Genome map
AA seq 390 aa AA seqDB search
MNLHEYQAKELLSRYGLPVQQGILAKSPEEAAAAYDKLGGKFAVVKAQVHAGGRGKAGGV
KVVKSREEAAEVAKTLIGTNLVTYQTDAAGQPVNSVLVCEDMYPVQRELYLGAVVDRGSQ
RVVFMVSTEGGVEIEKVAEETPEKIIKIEVDPLVGMQPFQARDAAFALGLSGAQVAAFSK
LMLGSYQAFIENDFALFEVNPLALRENGELACVDGKINLDSNALYRHPELLAQRDKSQEN
EREVKASEFDLNYVALEGNIGCMVNGAGLAMATMDIIKLKGGQPANFLDVGGGATKERVI
EAFKLILADTSVQGVLINIFGGIVRCDMIAEAIIAAVKEVNVTVPVVVRLEGNNAELGAK
ILDESGLKLTSAQGLNDAAEKIVAAVKAVA
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaacctgcatgaataccaagcgaaagagctgctgagccgttacggcctgccggtgcaa
caaggcattctggccaagtcgccggaagaggcggctgccgcttacgacaagctgggcggc
aaattcgccgtcgtgaaggcccaggtgcacgccggcggccgcggcaaggcgggcggcgtg
aaggtggtgaagagccgcgaggaagccgcggaagtcgccaagaccctgatcggcaccaac
ctggtgacctaccagaccgacgccgccggccagccggtgaacagcgtgctggtttgcgaa
gacatgtacccggtgcagcgcgaactgtacctgggcgccgtggtggaccgcggcagccag
cgcgtcgtgttcatggtttccaccgaaggcggcgtggaaatcgagaaggtggctgaagag
accccggaaaagatcatcaagatcgaagtggacccgctggtcggcatgcagccgttccag
gcgcgcgacgccgctttcgcgctgggcctgtccggcgcgcaggtcgccgcgttcagcaag
ctgatgctgggctcctaccaggccttcatcgagaacgacttcgccctgttcgaagtgaac
ccgctggcgctgcgcgaaaacggcgagctggcttgcgtggacggcaagatcaacctggac
tccaacgccctgtaccgccacccggaactgctggcccagcgcgacaagagccaggagaac
gagcgcgaagtgaaggcttccgagttcgacctgaactacgtggccctggaaggcaatatc
ggctgcatggtgaacggcgccggcctggcgatggctaccatggacatcatcaagctgaag
ggcggccagccggccaacttcctggacgtgggcggcggcgcgaccaaagagcgcgtgatc
gaagcgttcaagctgatcctggccgacacctcggtgcaaggcgtgctgatcaacatcttc
ggcggcatcgtccgctgcgacatgatcgccgaagccatcatcgccgccgtgaaggaagtg
aacgtgaccgtgccggtcgtggtccgtctggaaggcaacaacgccgagctgggcgccaag
atcctggacgaatccggcctgaaactgacttccgcccagggtctgaacgacgctgccgag
aagatcgtcgccgccgtcaaggccgtggcctga

DBGET integrated database retrieval system