KEGG   Chromobacterium violaceum: CV_1107Help
Entry
CV_1107           CDS       T00147                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
cvi  Chromobacterium violaceum
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:cvi00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    CV_1107
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CV_1107
Enzymes [BR:cvi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     CV_1107
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
LNCC_Brazil: 
UniProt: 
Position
1153078..1153656
Genome map
AA seq 192 aa AA seqDB search
MGWLGRENAMKRWGAMLMLWGQAALAACPALLNHSVPGLMGGQINLCQYADRPLLVVNTA
SHCGFTPQFTQLESLYKQYGPRGLMVIGFPSNDFFQELDKPSEIGAFCQANYGVTFPMAG
KGHVRGADAQPLFKDLIAATDDAPSWNFHKYLILPGASKVISIGTRTKPDAPEVVNAFLP
YLQPETQAAAKP
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgggctggctcggcagggagaacgccatgaaacgctggggagccatgttgatgctgtgg
gggcaggccgcgctggccgcgtgtccggccctgttgaaccactccgtgccggggctgatg
ggcgggcagatcaatctgtgccagtacgccgaccggccgctgctggtggtgaacaccgcc
agccattgcggcttcacgccgcagttcacgcaactggagtcgctatacaagcagtatggt
ccgcgcgggttgatggtgatcggctttcccagcaatgatttcttccaggagctggacaag
cctagcgagatcggcgccttctgccaggccaattacggcgtgacctttccgatggcgggc
aaggggcatgttcgaggcgccgatgcccagcctttgttcaaggatctgatcgccgccacc
gacgacgcgccgtcgtggaacttccacaagtacctgatcctgcccggcgccagcaaggtg
atcagcatcggcacccgcaccaagccggatgcgccggaggtggtcaacgccttcctgcct
tacttgcagccggaaacccaggctgcggccaagccctga

DBGET integrated database retrieval system