KEGG   Chromobacterium violaceum: CV_1325Help
Entry
CV_1325           CDS       T00147                                 

Definition
thiol-disulfide isomerase (EC:5.3.4.1)
Orthology
K01829  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
cvi  Chromobacterium violaceum
Brite
Enzymes [BR:cvi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     CV_1325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
LNCC_Brazil: 
UniProt: 
Position
1395172..1395639
Genome map
AA seq 155 aa AA seqDB search
MKKLLILLSLWLASAAALAGDLPYDELADAKAELSRTLDAAKQGRQPVLLILGANWCPDC
RALDAALNSGKSAELLAREFKVVKVDVGNFDHNLDIDAEYGHPIAKGIPAAVVLSPDNKV
VYATRAGELADARRMSETGIYEFFERVSRLGLTSQ
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactgctgattctattgtcgctgtggctggcgagcgccgccgcgttggcgggc
gacctgccgtatgacgagctggccgacgccaaggccgagttgagccggacgctggacgcg
gccaagcaaggccgtcagccggtgctgctgattttgggggccaactggtgcccggattgc
cgcgcgctggatgcggcgctgaacagcggcaagagcgctgagctgctggcgcgcgagttc
aaggtggtgaaggtggatgtcggcaatttcgaccataacctcgacatcgacgccgagtac
ggccatccgatagccaagggcattccggcggcggtggtgctgtcgccggacaacaaggtg
gtctacgcgacccgcgcaggagaactggccgacgcgcggcggatgagcgaaaccggcatc
tacgagttcttcgagcgcgtgagtcgactgggcctgacaagtcagtag

DBGET integrated database retrieval system