KEGG   Chromobacterium violaceum: CV_1570Help
Entry
CV_1570           CDS       T00147                                 

Definition
chelatase
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
cvi  Chromobacterium violaceum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cvi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CV_1570
Enzymes [BR:cvi01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     CV_1570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
LNCC_Brazil: 
UniProt: 
Position
complement(1683036..1684943)
Genome map
AA seq 635 aa AA seqDB search
MSPIYPFAAIVGQEQLKQALLICAVDPTVGGVLVRGDKGSAKSTAARGLAAVLPPIRRAA
GCGYNCEPDHPLPLCPVCSGGARELHDGPVPFINLPLGATEDRVLGSLDFEKALQGGKQA
FKPGLLAGAHRGMLYIDEVNLLADHLVDVLLDAAAMGVNTVEREGLAVSHPARVTLLGTM
NQEEGDLRPQLLDRFGLMVDVAAPREPGLRAEVVRRRLAFEADPAGFAAQWQTDSEALRE
NIAAARALLPHTRLSDQLFHFVSELCCEFEVSSLRADIVLNKAARALAALDGRIDASAED
IRDAARLVLPHRRRRKPFEQSGLDQDKLERMTRQASTPPPLPQDQGEATQPPPDADGEQE
PKPTGHGSEQIFAAAPAGDIARIRVQAPSTGDAAGRRSDGASRQRGHYVRAEANPQPAQL
AVDATLRHAILRDPDHFAVTRADLHDKVRVAKQGNLILLVVDASGSMAARQRMEQVKGTV
LSLLEDAYRRRDQVALIAFRGQKAELLLPPCNRVEQAEAALRELPTGGRTPLAHALALAA
DTLSRQLGGPAPLLVILSDGRANVALDGDGDPWRQALDLAGQLAGAPALVLDTEQDFVRL
GRARELAEALGAEYLACDALTGEQLTLTIQQRLGR
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgagtccgatctaccccttcgccgccatcgtcggccaagagcaattgaaacaggcgctg
ctgatctgcgcggtggaccccaccgtcggcggcgtgctggtgcgcggcgacaagggcagc
gccaagagcaccgccgcgcgcggcctggccgccgtgctgccgcctatccgccgcgccgcc
ggctgcggctacaactgcgagccggaccacccgctgccgctatgcccggtatgctccggc
ggcgcgcgcgagctgcatgacggcccggtgcccttcatcaacctgccactgggcgccacc
gaagaccgggtgctgggcagcctggacttcgaaaaggcgctgcaaggcggcaagcaggcg
ttcaagcccggcctgttggccggagcccaccgcggcatgctgtatatcgacgaagtgaac
ctgctggccgaccacctggtggacgtgctgctggacgccgccgcgatgggcgtcaacacc
gtcgagcgcgaggggctggcggtcagccacccggcgcgggtgacgctgctcggcaccatg
aaccaggaagaaggcgatctgcggccgcagttgctggaccgcttcggcctgatggtggac
gtggccgcgccgcgcgagcctggcttgcgcgccgaagtggtgcggcgccgcctggccttc
gaggccgacccggccggcttcgccgcccagtggcaaaccgacagcgaggcgctgcgcgaa
aacatcgccgccgcgcgcgcgctgctgccgcacacccggctcagcgaccaattatttcac
ttcgtcagcgagctgtgctgtgaattcgaagtcagcagcctgcgcgccgacatcgtgctg
aacaaggccgcacgcgcgctggccgcgctggacggccgcattgacgcctctgccgaagac
atccgcgacgccgcccggctggtgctgccgcaccgccgccgccgcaagcctttcgagcag
agcgggctggaccaggacaagctggagcggatgacgcggcaggcgtccacgccgcctccg
ctgccgcaggaccagggcgaggccacgcagccgccgccggacgccgacggcgagcaggag
ccgaagcctaccggccatggttcggagcagatcttcgccgccgcgccggccggcgacatc
gcccgcatccgcgtccaggcgccgtcgactggcgacgcggccggccgccgcagcgacggc
gccagccgccagcgcggacattacgtgcgcgccgaggccaatccgcagccggcccagctg
gcggtggacgccacgctgcgccacgcgatcttgcgcgatccggaccacttcgccgtcacc
cgcgccgacctgcacgacaaggtccgcgtcgccaagcagggcaacctgatcctgctggtg
gtggacgcgtcgggatcgatggccgcgcgccagcggatggagcaggtcaagggcacggtg
ctgagcctcttggaagacgcctaccgccgccgcgaccaggtggcgctgatcgccttccgc
ggccaaaaggccgagctgttgctgccgccgtgcaaccgcgtcgaacaagccgaagccgcg
ctgcgcgagctgcccaccggcggccgcacgccgctggcgcacgcgctggcgctggccgcc
gacacgctgtcccgccagctcggcggcccggcgccgctcttggtcatcctcagcgacggc
cgcgccaatgtggcgctggacggcgacggcgacccgtggcggcaggcgctggacctggcc
ggccagctggccggcgcgccggcgctggtgctggacaccgaacaggacttcgtccgcctg
ggccgcgcccgcgagctggccgaggccctgggcgcggaatacctggcttgcgacgccctc
accggcgagcagctgacattgacgattcaacaaagactgggccgctga

DBGET integrated database retrieval system