KEGG   Chromobacterium violaceum: CV_1612Help
Entry
CV_1612           CDS       T00147                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
cvi  Chromobacterium violaceum
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cvi03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
LNCC_Brazil: 
UniProt: 
Position
1739566..1740162
Genome map
AA seq 198 aa AA seqDB search
MKNPPALEQLISALKVLPGVGPKTAQRMAFHLLQRDKQGADKLARALDRALTQLTHCQRC
NTFSEAELCAICADETRRRDQLCIVEMPADLMMLEQAKCFDGLYFVLMGRISPLDNIGPK
DLHLDKLLARALDGQVSEIVIATNFTAEGEVTSHMLSELFKERGLTVTRIARGMPVGGEL
EYVDLGTLAQAVYERRGV
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatcctcccgcgctggagcagttgatctccgcgttgaaagtgttgccgggcgtg
gggccgaaaaccgcgcagcggatggctttccacctgctgcagcgcgacaagcagggcgcc
gacaagctggcgcgcgcgctggatcgggcattgacccagctcacgcattgccagcgctgc
aacaccttcagcgaggcggagctgtgcgccatctgcgccgacgagacgcgccgccgggac
cagctgtgcatcgtcgaaatgccggccgacctgatgatgctggagcaggccaagtgcttc
gacggcctgtatttcgtgctgatggggcggatttcgccgctggacaacatcgggcccaag
gacctgcacctggacaagctgttggcgcgggcgctggacgggcaggtgagcgagatcgtg
atcgccaccaacttcaccgccgagggcgaggtgacgtcccacatgctcagcgagttgttc
aaggagcgcggcctgacggtgacgcgcatcgcgcgcggcatgccggtgggcggcgagctg
gaatacgtcgacctgggcacgctggcgcaggcggtgtacgagcgccgcggcgtgtag

DBGET integrated database retrieval system