KEGG   Chromobacterium violaceum: CV_1633Help
Entry
CV_1633           CDS       T00147                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
cvi  Chromobacterium violaceum
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cvi00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
LNCC_Brazil: 
UniProt: 
Position
1771601..1772113
Genome map
AA seq 170 aa AA seqDB search
MTLAYVALGSNLEQPQQQVRAALAALGHLDGATLLRHSSLYRTAPVGYADQPDFINAVAL
LDTELPPLRLLDALLALEQRFGRQRSFRNAPRVLDLDLLYYDGVFLEEPRLILPHPRMRE
RAFVMVPLAEIAAGATLPGVGDIAALAADLAGSGVARLDDESNPNKQEQA
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
gtgacgctggcctacgtggctctgggcagcaatctggagcagcctcagcagcaagtcagg
gccgctcttgcggcccttggccatttggatggcgccacgttgctgcgccattcctcgctc
taccgcaccgcgccggtcggttacgccgaccagcccgatttcatcaacgcggtggccttg
ctggacacagagctgccgccgttgcgcctgctggacgcgttattggcgctggagcaacgc
ttcggccgccagcgcagcttccgcaacgcgccaagggtactggatcttgacttgttgtat
tacgatggcgtcttccttgaagagccccggctgatcctgccccatccgcgcatgcgcgag
cgcgccttcgtgatggtgccgctggccgagatcgccgccggcgccacgctgccgggcgtc
ggcgacatcgccgcgctggcggcggacctggccggttccggcgtggcgcgcctggacgac
gagtccaaccccaacaaacaggaacaagcatga

DBGET integrated database retrieval system