KEGG   Chromobacterium violaceum: CV_1653Help
Entry
CV_1653           CDS       T00147                                 

Gene name
hemG
Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
cvi  Chromobacterium violaceum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:cvi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CV_1653 (hemG)
Enzymes [BR:cvi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     CV_1653 (hemG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
LNCC_Brazil: 
UniProt: 
Position
1791071..1792405
Genome map
AA seq 444 aa AA seqDB search
MESIFRETIMIAVIGAGVSGLSCAWWLQRHGMPVRVFEAAERVGGKVSTLAGEALCEQGP
NTLLLDEELGQWLAELGLSPLWPEQGSDLRHVLQRGRYRPLPAGPWQLMAGGLLSWRAKW
QLLRGLLRPGDPAEAESSLAAFCRRRFGQEVLDKLLDPLACGVFAGDPEELALDETLPRL
ARAAARPLPLWKGLWRERAGRARMCTLPGGLQQLPQRLARDLDIKLGAPVTALRRDGDGW
RLRTREGWEWADRVVLAVPAAAAAELLHPLAPEMADVCRRIPYAPLAVVSTLLDGEAMEK
PLPGYGALHPSGEGALTLGHLTVSNIYPHVCPDGTRLVTSFIGGRKHPEWLEQDDDALLA
GLNQELERLFGMRGRPLAQHLTRWPQALPQGTPLQRRLRGAAEQWGGRGLHLCVNWLDGA
SLPDCLRKGRRLARRLAEREGGFA
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggaatcgatttttcgggagacgatcatgatcgcggtaatcggcgccggcgtttcaggg
ctgtcctgcgcctggtggctgcaacggcacggcatgccggtgcgggtgttcgaagcggcg
gaacgcgtcggcggcaaggtgagcaccttggcgggggaggcgctgtgcgagcaggggccc
aatacgctgctgctggacgaggaactggggcaatggctggcggagctcggcttgtcgccg
ctgtggcctgagcaagggagcgatttgcggcatgtgctgcagcgtgggcgctaccggccg
ttgcctgccggcccctggcaactgatggcgggcggcctgcttagctggcgggccaaatgg
cagctgttgcgcggactgttgcggccgggcgatccggccgaggccgagtcctcccttgcg
gctttctgccgccgccgtttcgggcaggaagtgctggacaagctgctggacccgctggcc
tgcggcgtgttcgccggggatccggaggaactggcgctggacgagacgctgcccaggctg
gcgcgggcggcggcgcggccgctgccattgtggaagggactgtggcgcgaaagggccggg
cgcgcccggatgtgcaccttgccaggcgggctgcagcaattgccgcagcggctggcgcgg
gatctggacatcaagctgggcgcgccggtgaccgcgctgcgccgcgacggcgacggctgg
cggctgcgtacccgcgagggttgggagtgggccgatcgggtggtgttggccgtgccggcc
gccgccgccgccgagctgctgcatccgctggcgccggaaatggccgacgtctgccggcgc
attccgtacgcgccgctggccgtggtgtccacgctgctggacggggaggcgatggagaag
ccgctgccaggctacggcgcgctgcatccgagcggggagggcgcgttgacgttgggccat
ctgacggtcagcaacatctatccgcacgtttgtcccgacggcacccggctggtgaccagc
ttcatcggcggccgcaagcatccggaatggctggaacaggacgacgacgcgctgctggcg
gggctcaaccaggagctggaacgcctgttcggcatgcgcggcaggccgctggcgcagcac
ctgacgcgttggccgcaggccttgccgcagggcacgccgctgcagcgccggctgcgcggc
gcggccgagcagtggggcggacggggcttgcatctgtgcgtcaactggctggatggcgca
tccctgccggattgcctgagaaaagggcggcggctggcccggcgattggcggagcgggaa
ggcggctttgcgtga

DBGET integrated database retrieval system