KEGG   Chromobacterium violaceum: CV_1745Help
Entry
CV_1745           CDS       T00147                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cvi  Chromobacterium violaceum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cvi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CV_1745 (pfkA)
   01230 Biosynthesis of amino acids
    CV_1745 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CV_1745 (pfkA)
   00030 Pentose phosphate pathway
    CV_1745 (pfkA)
   00051 Fructose and mannose metabolism
    CV_1745 (pfkA)
   00052 Galactose metabolism
    CV_1745 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    CV_1745 (pfkA)
Enzymes [BR:cvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CV_1745 (pfkA)
Protein phosphatases and associated proteins [BR:cvi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CV_1745 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
LNCC_Brazil: 
UniProt: 
Position
1895912..1897129
Genome map
AA seq 405 aa AA seqDB search
MTKPRAVYLQSGGPTAVLNASAQGAIETARRLGLSLYAAYDGLAGLLDGRLCDTDGVSDT
AIAQLAFMPGGSFGVSRRMIGTFEEAPEDWLRLRDVLAKHDIHYLLINGGNGSLGCAERL
VDFEKHTGYKLGVIGIPKTIDNDLVGTDNSPGYGSSAKFLASAMREVGLDMTSMGWGRVF
IMETMGRHTGWLAAACAAASRNPHEAPHLLLLPEVPFDQARFLAALDASLAKYGQCAIAV
AEGITGQDGRFVAEAKKSETYGHEQLGGAGHWLAQLILRERGISAHVAQVDYLQRAGGHL
ASATDVRQAYVMGERAVEWLLAGKTGLMAGIRRLNDHPYCWDVAEVPLSAVGDKEKRLPP
EFIGADGFSVTQAFLDYVKPLIEGERIPPFKDGLPDYRPIAWPRV
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagccaagagccgtatatctgcaatccggcggacccaccgccgttctgaacgct
tccgcccagggcgcgattgaaaccgcgcgtcgcctcggcctttccttgtacgccgcttac
gatggcctggcgggattgctggatggccgcctgtgcgataccgacggcgtgtccgacacc
gccatcgcccagctggccttcatgcccggcggcagcttcggcgtcagccgccgcatgata
ggcacgttcgaggaagcgccggaagactggctgcggctgcgcgacgtgctggccaagcac
gacatccactacctgctgatcaacggcggcaacggttcgctgggctgcgccgagcgcctg
gtcgatttcgaaaagcacaccggctacaagctgggcgtgatcggcatccccaagaccata
gacaacgacctggtcggcaccgacaacagccccggctacggctcctccgccaaattcctg
gccagcgcgatgcgcgaggtcggcctggacatgaccagtatgggctggggccgggtgttc
atcatggaaaccatgggccgccacaccggctggctggcggccgcctgcgccgccgcctcc
cgcaatccgcacgaagcgccgcatttgctgctgttgcccgaggtgccgttcgaccaggcg
cgcttcctggcggcgctggacgccagcctggcgaagtacggccagtgcgcgatcgcggtg
gccgaaggcatcaccggccaggacggccgcttcgtcgccgaggccaagaagtccgaaacc
tacggccacgagcaactgggcggcgccggccactggctggcccagctgatcctgcgcgag
cgcggcatctccgcccacgtggcgcaggtggactatctgcagcgcgccggcggccacctg
gcttccgccaccgacgtccgccaggcctacgtgatgggcgagagggcggtggagtggctg
ctggccggcaagaccggcctgatggccggcatcaggcggctgaacgaccatccttactgc
tgggacgtggccgaagtgccgctgtcggcggtgggcgacaaggagaagcggctgccgccg
gagttcatcggcgccgacggcttcagcgtcacccaggctttcctggactacgtgaagccg
ttgatagagggcgagcgcatcccgccgttcaaggacggcttgccggactaccgcccgatc
gcctggccgcgggtctga

DBGET integrated database retrieval system