KEGG   Chromobacterium violaceum: CV_2073Help
Entry
CV_2073           CDS       T00147                                 

Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
cvi  Chromobacterium violaceum
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cvi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CV_2073
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    CV_2073
Enzymes [BR:cvi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     CV_2073
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
LNCC_Brazil: 
UniProt: 
Position
2258209..2259282
Genome map
AA seq 357 aa AA seqDB search
MNLPRGPVMVDIAGFALTEAERARLSHPLVGGVILFRRNFHNIEQLRALTAEIRALRTPH
LLIAVDHEGGRVQRFLDGFTRLPPMRVLGEAWDADRDQALKLAETVGYVLAAELSACGID
LSFTPVLDLDWERCAVIGNRAFHRDPEAVSALAEALQQGLGRGGMMSCGKHYPGHGYVEG
DSHHLMPQDDRTLAQIEQDDLVPFARLADAGMGAVMPAHVLYPAVDSQPAGFSKVWLTDI
LRGRIGFDGVIFSDALDMAGAAGAGTYVQRADAALAAGCDMVLVCNQPEEADAMLAALAP
PPQPQLAERLERMAGKSRAEDWQRLIATPDFAAAQAAVRQLAMPKDALAGPQVGEAH
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
ttgaatctcccgcgcggcccggtgatggtggacatcgccggcttcgcgctgaccgaagcg
gaacgcgcccggctgtcccatccgctggtcggcggcgtcatcctgtttcgccgcaatttc
cacaacatcgaacaactgcgcgcgctgaccgccgagatccgcgccttgcgtacgccgcat
ctgttgatcgccgtcgatcacgagggcgggcgcgtgcagcgcttcctggacggcttcacc
cgcctgccgccgatgcgcgtgctgggcgaggcctgggatgccgaccgcgaccaggcgctg
aagctggccgagactgtgggctacgtgctggcggccgaattgtccgcctgcggcatagac
ctgtccttcaccccggtgctggacctggactgggagcgttgcgcggtgatcggcaaccgc
gccttccaccgcgatccggaggcggtgtcggcgctggccgaagcgctgcagcaaggcctg
ggccgcggcggcatgatgagctgcggcaagcactatcccggccacggctatgtggagggc
gacagccaccatctgatgccgcaggacgatcgcacgctggcacagatcgaacaggacgat
ctggtgccgttcgcccgtctggccgacgccggcatgggcgcggtgatgccggcccacgtg
ctgtacccggcggtggatagccagccggcgggcttctccaaggtgtggctgaccgacatc
ctgcgcggcaggataggcttcgacggcgtgatcttctccgacgcgctggacatggccggc
gcggccggcgccggcacttacgtgcagcgcgccgacgcggcgctggccgccggctgcgac
atggtgttggtgtgcaaccagccggaagaggcggacgcgatgctggccgcgctggcgccg
ccgccgcaaccccagctggcggagcggctggagcgcatggcgggcaagagccgcgccgaa
gattggcagcgcttgatcgccacgccggatttcgccgccgcgcaggcggcggtcaggcaa
ttggcgatgcccaaggacgcgctggccgggccgcaagtgggcgaggcgcactga

DBGET integrated database retrieval system