KEGG   Chromobacterium violaceum: CV_2172Help
Entry
CV_2172           CDS       T00147                                 

Gene name
algC
Definition
phosphomannomutase (EC:5.4.2.2 5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
cvi  Chromobacterium violaceum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cvi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CV_2172 (algC)
   00030 Pentose phosphate pathway
    CV_2172 (algC)
   00051 Fructose and mannose metabolism
    CV_2172 (algC)
   00052 Galactose metabolism
    CV_2172 (algC)
   00500 Starch and sucrose metabolism
    CV_2172 (algC)
   00520 Amino sugar and nucleotide sugar metabolism
    CV_2172 (algC)
  Nucleotide metabolism
   00230 Purine metabolism
    CV_2172 (algC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CV_2172 (algC)
Enzymes [BR:cvi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     CV_2172 (algC)
    5.4.2.8  phosphomannomutase
     CV_2172 (algC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
LNCC_Brazil: 
UniProt: 
Position
complement(2345191..2346567)
Genome map
AA seq 458 aa AA seqDB search
MNKISKDIFKAYDIRGIVGKTLTAAVARQIGQAVASEAIDRKVKAIVIGRDGRLSGPELS
EALAEGIRAAGVDVIDVGRVATPMLYFAAHQLGTLSGVMVTGSHNPPDYNGFKMMLAGDT
LAGDDIQALYQRIVDGRLAEGEGGYRTEDIAEAYLERITSDIKLERPLNIVVDSGNGVAG
AFGPLLYRRLGCKVRELFCDVDGNFPNHHPDPAKPENLKDLIEALQKTDAEIGLAFDGDG
DRLGVVTKDGNIIWPDRQLMLYAADVLDRNPKAKVIFDVKSTRLLKPWIKKNGGVPVMAR
TGHSFIKAKIKETGALLAGEMSGHVFFKERWYGFDDGIYTGARLLEVLSRVEDPSELLNA
LPNAVSTPELNLKMAKEGENHALISRLQESASFDGAEEVNTLDGLRVEYKDGFGLARASN
TTPVIVLRFEADTEEALERIKGDFRRVLATATDAKLPF
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaatatccaaagacatcttcaaggcgtatgacatccgcggcatcgtcggcaag
accctgaccgccgccgtcgctcggcaaatcggccaagccgtggcttcggaagccattgac
cgcaaggtcaaggccatcgtgatcggccgcgacggccgcctgtccggccccgaattgagc
gaggcgctggctgaaggcatccgcgccgccggcgtcgacgtgatcgacgtcggccgcgtc
gccacgcccatgctgtacttcgccgcccatcagctgggcaccctgtccggcgtgatggtg
accggcagccacaatccgcccgactacaacggcttcaagatgatgctggccggcgacacg
ctggccggcgacgacatccaggcgctttaccagcgcatcgtcgatggccggctcgccgag
ggcgaaggcggctatcgcaccgaagacatcgcggaagcctacctggagcgcatcacctcc
gacatcaagcttgagcgtccgctgaacatcgtggtggacagcggcaacggcgtggccggc
gccttcggcccgctgctgtaccgccgcctgggctgcaaggtgcgcgagctgttctgcgac
gtggacggcaatttccccaaccaccacccggacccggccaagccggaaaacctgaaagac
ctgatcgaggcgctgcagaaaaccgacgccgagatcggcctggccttcgacggcgacggc
gaccgcctgggcgtggtgaccaaggacggcaacatcatctggccggatcgccagctgatg
ctgtacgccgccgacgtgctggaccgcaatcccaaggccaaggtgatcttcgacgtcaaa
tccacccggctgctcaagccctggatcaagaagaacggcggcgtgccggtaatggcgcgc
accggccacagcttcatcaaggccaagatcaaggaaaccggcgcgctgctggccggcgag
atgagcggccacgtgttcttcaaggaacgctggtacggcttcgacgacggcatctacact
ggcgcccgcctgctggaagtgctgtcccgcgtcgaggatcccagcgagctcttgaacgcg
ctgcccaacgccgtctccacgccagaactgaacctgaagatggccaaggagggcgagaac
cacgcgctgatctccaggctgcaggagtccgccagctttgacggcgccgaggaagtgaac
acgctggacggcctgcgcgtcgagtacaaggacggcttcggcctggcccgcgcatccaat
accacgccggtgatcgtgctgcgcttcgaggccgacaccgaggaggcgctggaacgcatc
aagggcgatttccgccgcgtgctggccaccgccaccgacgccaagctgccgttctaa

DBGET integrated database retrieval system