KEGG   Chromobacterium violaceum: CV_2218Help
Entry
CV_2218           CDS       T00147                                 

Definition
hypothetical protein
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
cvi  Chromobacterium violaceum
Brite
KEGG Orthology (KO) [BR:cvi00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    CV_2218
Enzymes [BR:cvi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     CV_2218
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
LNCC_Brazil: 
UniProt: 
Position
2389062..2392517
Genome map
AA seq 1151 aa AA seqDB search
MVRIATPISEIKEHYEVVVIGSGYGGGIAASRMARAGRSVCLLERGREIIPGEYPDTLAE
ATEEFQVHHPDGHLGSRTGLYDLHVNAQQNVIVGCGLGGTSLINANVSLQPEPQVFEDPR
WPQGVRDHVDTLLKEGYARAQQMLKPTPYPEAAPTLPKLQANQKSGERIKAKHTFYRPPI
NVTFEKLPNDLNHVGVEQKPCNYCGDCVSGCNNRAKNTTLMNYLPDACNHGAEIFCQASV
RYLERDGDGWIVHYQYVGTGREKFDAPTLFVKADIVILSAGTLGSTEILLRSRAEGLALS
DQLGMHMSGNGDILGFGYNNGDKINGIGFGTHSAKEIGPVGPCITSIIDMRDESGWRRRM
VIEEGSIPGAIGGVMVPAMAAASAELGQPSETGALAKIKYAAREVESALRGPYHGAMNRL
QTYLIMSHDDGAGRMALDDHDQLRVDWPDVGEQPNFKIGNDRLQEATHALGGIYVRNPIW
TDLFKHSLITVHPLGGCVMGEDAEQGVVNHKGQAFSGASGSAVYPGLYVTDGSVIPTSLA
VNPLFTISAVSERAMALLAADRGWTIDYSLPSAPRRGQPQSNKPGIEFTETMKGFFSTAH
RQPASTDLAAYEAAYQAGKDAGSAMGFTVTVASDDLDRLIADPSHPATIVGTLNAPALSP
LPLTVTHGVFNLFEAYPQQVGERHMNYKMRLTAEDGVEYFFSAFKSVPSDHGPLQAWADT
STLYVTVYRGVDDGGEVVGSGVLHIEPADFARQMTTMKVLNVSSEAERLKQLARFGEYFA
GVLWESYGGVLAPNVYFNPDAPPRKKRPLNVCAPEVVFFPTEDGVNLRLTRYNGGGKGPV
MLVHGLGVGSNIFSTDTISTNLLEYLYQHGYDVWLLDFRVSILLPASQQQWDGDQVARYD
YPAAIRRIREATGAADVQCVVHCYGATTFFMSMLAGLEGVRSVVCSQIAADIVVPTATQV
KTGLHLPTVLDKLGVSSLTAYTASDSNWFEKLYDTALKGYALAEAQGYCNNPVCHRITFM
YASLYRHETLNETLHDNLHELFGVANMRTMEHLARMCREGRLVSFDGDDIYMPHFDRLQM
PILFISGEQNECYLPESTERTFDKLAQRFGPERYSRLVVPGYGHIDCMFGKNAAADVYPA
IVAHLDKTAGG
NT seq 3456 nt NT seq  +upstreamnt  +downstreamnt
atggtgcgaatcgctactcccatcagtgaaatcaaggaacattacgaagtcgtggtgatc
ggctccggctacggcggcggcatcgccgcgtcgcggatggccagagccggacgctcggtc
tgcctgctggagcggggtcgggagatcatccccggcgagtatcccgacacgctggcggag
gcgaccgaggaattccaggtccatcatccggacggacacctcggctcgcgcaccggcctt
tacgatttgcatgtcaacgcgcagcagaacgtcatcgtcggctgcggcctgggcggcacc
tcgctgatcaacgccaacgtctcgctgcagccggaaccgcaggtattcgaggatccgcgc
tggccgcagggcgtgcgcgatcatgtggacacgttgctgaaggaggggtacgcgcgggcg
cagcaaatgctgaagcccacgccttatccggaagccgcgccgacgctgcccaagctgcag
gccaaccaaaagtcgggcgagcgcatcaaggccaagcataccttctaccgcccgcctatc
aacgtcaccttcgagaaactgcctaacgatctcaaccacgtcggcgtcgagcagaaaccg
tgcaattactgcggcgactgcgtgtccggctgcaacaaccgcgccaagaacaccacgctg
atgaactatctgccggatgcctgcaaccacggcgcggagattttctgccaggcgtcggtg
cgctatctggagcgggacggcgacggctggatcgtccattaccagtacgtgggcaccggg
cgcgagaagttcgacgcgcctacgctgttcgtcaaggcggacatcgtcatcctgtccgcg
ggcacgctcggctccaccgagatcctgctgcgctcccgcgccgaaggcctggccctgtcc
gaccagctgggcatgcacatgagcggcaacggcgacatcctgggtttcggctacaacaac
ggcgacaagatcaacggcatcggtttcggcacgcactcggccaaggagatcggcccggtc
ggtccctgtatcacctccatcatcgacatgcgcgacgagagcggctggcggcggcgcatg
gtgatagaggagggctccatccccggcgccatcggcggcgtgatggtgccggcgatggcc
gcggcctcggccgagctgggccagccgtcggaaaccggcgcgctggccaagatcaagtat
gcggcgcgcgaggtggagagcgcgctgcgcggcccatatcacggcgcgatgaaccgcttg
cagacttatctgatcatgagccacgacgacggcgccggacggatggcgctggacgatcac
gaccagctgcgggtggactggcccgatgtgggcgagcagcccaacttcaagatcggcaac
gacaggctgcaggaggccacccacgcgctgggcggcatctacgtgcgcaatccgatctgg
accgacctgttcaagcacagcctgatcaccgtccacccgctgggcggctgcgtgatggga
gaagacgcggagcagggcgtggtcaaccacaagggccaggcattcagcggggcgagcggc
agcgccgtctatcccgggctgtacgtgaccgacggctcggtgattcccacctcgctggcg
gtgaacccgctgttcaccatctccgcggtcagcgaaagggcgatggcgctgctggccgcc
gaccgcggctggacgatagactactcgcttccgtccgcgcctcgccgcgggcagccgcag
tcgaacaagccgggcatcgaattcaccgagacgatgaaaggcttcttttccaccgctcac
cgccaaccggcgagcacggacctggccgcgtacgaggcggcgtatcaggccggcaaggac
gccggctcggcgatgggcttcaccgtcaccgtggcctcggacgatctggacaggctgatc
gccgatcccagccatccagccaccattgtcggcacgctgaatgcgccggcgctgtcgccg
ttgccgctgacggtgacccacggcgtgttcaatctgttcgaggcgtatccgcaacaggtg
ggcgagcgccacatgaactacaagatgcggctgacggcggaggatggcgtcgagtatttc
ttcagcgcgttcaagtcggtgcccagcgaccacggtccgctccaggcctgggccgatacc
agcacgctgtacgtgacggtgtaccggggcgtggacgatggaggcgaggtggtcggcagc
ggcgtgctgcacatcgagccggccgacttcgcgcggcagatgaccacgatgaaggtgctc
aacgtctccagcgaggcggagcggctgaagcagcttgcccgcttcggcgagtatttcgcc
ggcgtgctgtgggagagctacggcggggtgctggcgcccaatgtctacttcaatccggac
gcgccgccgcgcaagaagcgcccgctcaacgtctgcgcgcccgaggtggtgttctttccg
accgaggacggcgtcaacctgcggctcacccgctacaacggcggcggcaagggcccggtg
atgctggtgcacggcctgggcgtgggatcgaacatcttctccaccgacaccatctccacc
aatctgctggagtacctgtaccagcacggctacgacgtatggctgctggacttccgcgtc
agcatcctgctgccggcgagccagcagcagtgggacggcgaccaggtggcgcgctacgac
tatccggcggcgatccgtaggatacgcgaggccaccggcgcggccgacgtgcagtgcgtg
gtgcactgctacggcgccaccaccttcttcatgtccatgctggccggcctggagggcgtg
agatcggtggtgtgctcgcagatcgccgccgacatcgtggtgccgaccgccacccaggtg
aagaccggcctgcacctgccgacggtgctggacaagctgggcgtgtcgtcgttgaccgcc
tacaccgcgtcggactccaactggttcgagaaattgtacgacaccgcgttgaagggttac
gcgctggcggaggcgcagggctattgcaacaacccggtctgccaccgcatcaccttcatg
tacgcatcgctgtaccgccatgaaaccctgaacgagacgctgcacgacaatctgcacgaa
ctgttcggcgtggcgaacatgcgcaccatggagcatctggcgcggatgtgccgcgagggg
cggctggtgtccttcgacggcgacgacatctacatgccgcacttcgaccggttgcaaatg
cccattctgttcatcagcggcgaacagaacgagtgctacctgccggagagcacggagcgc
acgttcgacaagctggcgcagcgcttcggtcctgagcgttacagccggctggtggtgccg
ggctacggccacatcgactgcatgttcggcaagaacgcggcggccgatgtctatccggcc
atcgtcgcgcatctggacaagaccgcaggcggctga

DBGET integrated database retrieval system