KEGG   Chromobacterium violaceum: CV_2218Help
Entry
CV_2218           CDS       T00147                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K03333  cholesterol oxidase [EC:1.1.3.6]
Organism
cvi  Chromobacterium violaceum
Pathway
cvi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cvi00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    CV_2218
Enzymes [BR:cvi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     CV_2218
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GMC_oxred_C GMC_oxred_N Abhydrolase_1 Pyr_redox_2 FAD_oxidored FAD_binding_2 Pyr_redox NAD_binding_8 HI0933_like GIDA FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AAQ59890
LNCC_Brazil: CV2218
UniProt: Q7NVX3
Position
2389062..2392517
Genome map
AA seq 1151 aa AA seqDB search
MVRIATPISEIKEHYEVVVIGSGYGGGIAASRMARAGRSVCLLERGREIIPGEYPDTLAE
ATEEFQVHHPDGHLGSRTGLYDLHVNAQQNVIVGCGLGGTSLINANVSLQPEPQVFEDPR
WPQGVRDHVDTLLKEGYARAQQMLKPTPYPEAAPTLPKLQANQKSGERIKAKHTFYRPPI
NVTFEKLPNDLNHVGVEQKPCNYCGDCVSGCNNRAKNTTLMNYLPDACNHGAEIFCQASV
RYLERDGDGWIVHYQYVGTGREKFDAPTLFVKADIVILSAGTLGSTEILLRSRAEGLALS
DQLGMHMSGNGDILGFGYNNGDKINGIGFGTHSAKEIGPVGPCITSIIDMRDESGWRRRM
VIEEGSIPGAIGGVMVPAMAAASAELGQPSETGALAKIKYAAREVESALRGPYHGAMNRL
QTYLIMSHDDGAGRMALDDHDQLRVDWPDVGEQPNFKIGNDRLQEATHALGGIYVRNPIW
TDLFKHSLITVHPLGGCVMGEDAEQGVVNHKGQAFSGASGSAVYPGLYVTDGSVIPTSLA
VNPLFTISAVSERAMALLAADRGWTIDYSLPSAPRRGQPQSNKPGIEFTETMKGFFSTAH
RQPASTDLAAYEAAYQAGKDAGSAMGFTVTVASDDLDRLIADPSHPATIVGTLNAPALSP
LPLTVTHGVFNLFEAYPQQVGERHMNYKMRLTAEDGVEYFFSAFKSVPSDHGPLQAWADT
STLYVTVYRGVDDGGEVVGSGVLHIEPADFARQMTTMKVLNVSSEAERLKQLARFGEYFA
GVLWESYGGVLAPNVYFNPDAPPRKKRPLNVCAPEVVFFPTEDGVNLRLTRYNGGGKGPV
MLVHGLGVGSNIFSTDTISTNLLEYLYQHGYDVWLLDFRVSILLPASQQQWDGDQVARYD
YPAAIRRIREATGAADVQCVVHCYGATTFFMSMLAGLEGVRSVVCSQIAADIVVPTATQV
KTGLHLPTVLDKLGVSSLTAYTASDSNWFEKLYDTALKGYALAEAQGYCNNPVCHRITFM
YASLYRHETLNETLHDNLHELFGVANMRTMEHLARMCREGRLVSFDGDDIYMPHFDRLQM
PILFISGEQNECYLPESTERTFDKLAQRFGPERYSRLVVPGYGHIDCMFGKNAAADVYPA
IVAHLDKTAGG
NT seq 3456 nt NT seq  +upstreamnt  +downstreamnt
atggtgcgaatcgctactcccatcagtgaaatcaaggaacattacgaagtcgtggtgatc
ggctccggctacggcggcggcatcgccgcgtcgcggatggccagagccggacgctcggtc
tgcctgctggagcggggtcgggagatcatccccggcgagtatcccgacacgctggcggag
gcgaccgaggaattccaggtccatcatccggacggacacctcggctcgcgcaccggcctt
tacgatttgcatgtcaacgcgcagcagaacgtcatcgtcggctgcggcctgggcggcacc
tcgctgatcaacgccaacgtctcgctgcagccggaaccgcaggtattcgaggatccgcgc
tggccgcagggcgtgcgcgatcatgtggacacgttgctgaaggaggggtacgcgcgggcg
cagcaaatgctgaagcccacgccttatccggaagccgcgccgacgctgcccaagctgcag
gccaaccaaaagtcgggcgagcgcatcaaggccaagcataccttctaccgcccgcctatc
aacgtcaccttcgagaaactgcctaacgatctcaaccacgtcggcgtcgagcagaaaccg
tgcaattactgcggcgactgcgtgtccggctgcaacaaccgcgccaagaacaccacgctg
atgaactatctgccggatgcctgcaaccacggcgcggagattttctgccaggcgtcggtg
cgctatctggagcgggacggcgacggctggatcgtccattaccagtacgtgggcaccggg
cgcgagaagttcgacgcgcctacgctgttcgtcaaggcggacatcgtcatcctgtccgcg
ggcacgctcggctccaccgagatcctgctgcgctcccgcgccgaaggcctggccctgtcc
gaccagctgggcatgcacatgagcggcaacggcgacatcctgggtttcggctacaacaac
ggcgacaagatcaacggcatcggtttcggcacgcactcggccaaggagatcggcccggtc
ggtccctgtatcacctccatcatcgacatgcgcgacgagagcggctggcggcggcgcatg
gtgatagaggagggctccatccccggcgccatcggcggcgtgatggtgccggcgatggcc
gcggcctcggccgagctgggccagccgtcggaaaccggcgcgctggccaagatcaagtat
gcggcgcgcgaggtggagagcgcgctgcgcggcccatatcacggcgcgatgaaccgcttg
cagacttatctgatcatgagccacgacgacggcgccggacggatggcgctggacgatcac
gaccagctgcgggtggactggcccgatgtgggcgagcagcccaacttcaagatcggcaac
gacaggctgcaggaggccacccacgcgctgggcggcatctacgtgcgcaatccgatctgg
accgacctgttcaagcacagcctgatcaccgtccacccgctgggcggctgcgtgatggga
gaagacgcggagcagggcgtggtcaaccacaagggccaggcattcagcggggcgagcggc
agcgccgtctatcccgggctgtacgtgaccgacggctcggtgattcccacctcgctggcg
gtgaacccgctgttcaccatctccgcggtcagcgaaagggcgatggcgctgctggccgcc
gaccgcggctggacgatagactactcgcttccgtccgcgcctcgccgcgggcagccgcag
tcgaacaagccgggcatcgaattcaccgagacgatgaaaggcttcttttccaccgctcac
cgccaaccggcgagcacggacctggccgcgtacgaggcggcgtatcaggccggcaaggac
gccggctcggcgatgggcttcaccgtcaccgtggcctcggacgatctggacaggctgatc
gccgatcccagccatccagccaccattgtcggcacgctgaatgcgccggcgctgtcgccg
ttgccgctgacggtgacccacggcgtgttcaatctgttcgaggcgtatccgcaacaggtg
ggcgagcgccacatgaactacaagatgcggctgacggcggaggatggcgtcgagtatttc
ttcagcgcgttcaagtcggtgcccagcgaccacggtccgctccaggcctgggccgatacc
agcacgctgtacgtgacggtgtaccggggcgtggacgatggaggcgaggtggtcggcagc
ggcgtgctgcacatcgagccggccgacttcgcgcggcagatgaccacgatgaaggtgctc
aacgtctccagcgaggcggagcggctgaagcagcttgcccgcttcggcgagtatttcgcc
ggcgtgctgtgggagagctacggcggggtgctggcgcccaatgtctacttcaatccggac
gcgccgccgcgcaagaagcgcccgctcaacgtctgcgcgcccgaggtggtgttctttccg
accgaggacggcgtcaacctgcggctcacccgctacaacggcggcggcaagggcccggtg
atgctggtgcacggcctgggcgtgggatcgaacatcttctccaccgacaccatctccacc
aatctgctggagtacctgtaccagcacggctacgacgtatggctgctggacttccgcgtc
agcatcctgctgccggcgagccagcagcagtgggacggcgaccaggtggcgcgctacgac
tatccggcggcgatccgtaggatacgcgaggccaccggcgcggccgacgtgcagtgcgtg
gtgcactgctacggcgccaccaccttcttcatgtccatgctggccggcctggagggcgtg
agatcggtggtgtgctcgcagatcgccgccgacatcgtggtgccgaccgccacccaggtg
aagaccggcctgcacctgccgacggtgctggacaagctgggcgtgtcgtcgttgaccgcc
tacaccgcgtcggactccaactggttcgagaaattgtacgacaccgcgttgaagggttac
gcgctggcggaggcgcagggctattgcaacaacccggtctgccaccgcatcaccttcatg
tacgcatcgctgtaccgccatgaaaccctgaacgagacgctgcacgacaatctgcacgaa
ctgttcggcgtggcgaacatgcgcaccatggagcatctggcgcggatgtgccgcgagggg
cggctggtgtccttcgacggcgacgacatctacatgccgcacttcgaccggttgcaaatg
cccattctgttcatcagcggcgaacagaacgagtgctacctgccggagagcacggagcgc
acgttcgacaagctggcgcagcgcttcggtcctgagcgttacagccggctggtggtgccg
ggctacggccacatcgactgcatgttcggcaagaacgcggcggccgatgtctatccggcc
atcgtcgcgcatctggacaagaccgcaggcggctga

DBGET integrated database retrieval system