KEGG   Chromobacterium violaceum: CV_2361Help
Entry
CV_2361           CDS       T00147                                 

Gene name
mtrA
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
cvi  Chromobacterium violaceum
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cvi00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
LNCC_Brazil: 
UniProt: 
Position
2548084..2548782
Genome map
AA seq 232 aa AA seqDB search
MSKIDKQDQQEAISQRIRYRLQAAGARFHANDNISAFIEDGELDALQEEVQAKLKGVLES
LVIDTANDHNTQETAKRVAKMFVREVFRGRYVSMPPCTEFPNVEHLNELMIIGPITVRSA
CSHHLCPIIGRVWVGVLPNEASNLIGLSKYARLIDWVMTRPQIQEEAVSQIADLLMQKLQ
PDGLAIVMEADHFCMHWRGVKDSNSKMTNSVMRGSFLTNPDLRKEFLSLMRK
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaatcgacaagcaggaccagcaggaagcgatatcgcagcgcatccgttaccgg
ttgcaggcggcgggggcgcgcttccatgccaacgacaatatatcggcctttatcgaggac
ggagagctggatgcattgcaggaagaggtgcaggccaagctcaagggcgtgctggaaagc
ttggtgatcgataccgcgaacgaccacaacacgcaggagaccgcgaagcgggtggcgaag
atgttcgtccgcgaagtatttcgggggcgctacgtgtcgatgcctccctgcaccgaattc
ccgaatgtcgagcatctgaacgagctgatgatcatcgggccgatcacggtgcgcagcgcc
tgctcccatcatctttgccccatcatcggccgggtgtgggtgggcgtgctgccgaacgag
gcttcgaacctgatcgggctgtccaaatacgcccgcctgatagattgggtgatgacccgt
ccgcagatacaggaagaggcggtatcgcagatagcggatttgctgatgcagaagctgcag
cctgacggtctggccatcgtgatggaggcggatcacttctgcatgcactggcgcggcgtg
aaggacagcaacagcaagatgaccaatagcgtgatgcgcggctccttcctgaccaatccg
gacctgcgcaaggaatttctgtccttgatgcggaagtga

DBGET integrated database retrieval system