KEGG   Chromobacterium violaceum: CV_2611Help
Entry
CV_2611           CDS       T00147                                 

Gene name
slt
Definition
(GenBank) peptidoglycan N-acetylmuramoylhydrolase
  KO
K01185  lysozyme [EC:3.2.1.17]
Organism
cvi  Chromobacterium violaceum
Brite
Enzymes [BR:cvi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     CV_2611 (slt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SLT Glucosaminidase
Motif
Other DBs
NCBI-ProteinID: AAQ60281
LNCC_Brazil: CV2611
UniProt: Q7NUT6
Position
2819331..2819951
Genome map
AA seq 206 aa AA seqDB search
MVWTRGPEPSARAGSEPAASSQPVSSGPETKTAPQDGIAAHLPLAHKISHELDLDPKLLH
AIIKVESGYRPRAISSKGAQGLMQVMPETGKRFGFTDLMNPENNLRAGASYLKWLLNHFE
NDLELAIAGYNAGEGAVKKHGRKIPPYPETQNYVKKVMASYSEPESHPLPPSPSPAPRKT
QTPPPAGKSIPAKLFGLLLSSPLAPS
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
ttggtctggacccggggtccagagccatccgctcgcgcaggttcggagccggcggcctcc
agccaacccgtctcatccggcccggaaaccaagacagcacctcaagacggcatcgccgcg
catctgccgctggcccataaaatatcccatgagctggatctcgatcccaaactgctgcat
gcgatcatcaaggtcgaatccggctatcggcctcgggccatctcgtcaaagggtgcccaa
ggcctgatgcaggtgatgccggaaaccgggaaacgctttggatttaccgatttgatgaat
ccggaaaacaacttgcgcgccggcgccagctatctgaaatggctgctgaatcacttcgag
aacgatctggagcttgcaatcgccggatataacgcaggagaaggcgcagttaaaaagcat
ggcaggaaaatcccgccttatccggaaacgcaaaactatgtaaaaaaggtaatggcatcg
tattcggagccagaatcccatcccttgcctccaagcccctcccccgcaccccgcaaaacc
cagacaccgccccctgcgggaaaatccatcccggccaagctattcggcttgctgctgtca
tctccgctcgccccttcctag

DBGET integrated database retrieval system