KEGG   Chromobacterium violaceum: CV_2676Help
Entry
CV_2676           CDS       T00147                                 

Gene name
bscZ
Definition
endo-1,4-D-glucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
cvi  Chromobacterium violaceum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cvi00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
LNCC_Brazil: 
UniProt: 
Position
complement(2896544..2897692)
Genome map
AA seq 382 aa AA seqDB search
MSAVSIPLFAALLLDALPALAAPCDGWPDWQAFLKNYVSGDGRVVDRSQDARPTTSEGQS
YALFFALAANDRPAFDRLLAWTRDNLADGDLGARLPAWLWGRGQDGGWKVLDDNSASDSD
MWLAYDLLEAGRLWREPSYAAQGRQLALRILREETADLPGLGLTLLPGKDGFLFSDGGAR
LNPSYLPPQLLARFAYGLPDSDWAKLPSGSERVLLDGAPAGFAPDWLRLQPGKGLQPDAD
SKAKGGYSAIRVYLWAGMLAPSAPLRAALLARYKPMARWVAREGAPPEQVDTRNGKAQGR
APTGFSFALLPFLQAQGETEALRALLQRLRAMPRDDRADAYYDQVLRLFGLGWLQGRFRF
ERNGKLLPAWEGKCSASLPVSR
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgtcggccgtttccatcccgctgttcgcggcgttgctgctggacgcgctgccggcattg
gcggccccctgcgatggctggccggactggcaggcgttcctgaagaactatgtttccggc
gacggcagggtggtggatcgcagccaggacgccaggcccaccacctcggaaggccaaagc
tacgccttgttcttcgcattggcggccaacgaccggccggcgttcgaccgactgctggcc
tggacccgcgacaatctggccgacggcgatctgggcgcgcgcctgccggcctggttgtgg
gggcgggggcaggacggcggatggaaggtattggacgacaacagcgcgtcggattccgac
atgtggctcgcttacgacctgctggaggctgggcggttgtggcgcgagccgagctatgcg
gcgcagggcaggcagctggcgctccggatcctgagggaagaaaccgccgacctgcccgga
ctgggcctgacgctgctgcccggcaaggatggcttcttgttttccgacggcggtgcccgg
ctcaatcccagttacctgccgccgcagctgctggcccgtttcgcctacggcttgcctgat
tccgactgggcgaagctgccgagcggcagcgaacgcgtgctgctggacggcgcgccggca
ggcttcgcgcccgactggctgagacttcagccgggcaaggggctgcagccggacgcggac
agcaaggcgaagggcggctacagcgccatccgcgtctacctgtgggcgggcatgcttgcg
ccgtccgcgccgctgcgcgccgcgctgctggccaggtacaaacccatggcgcgctgggtg
gcgcgggagggcgcgcctcccgaacaggtggacacccgcaatggcaaggcgcagggaagg
gctccgacggggttttccttcgccttgctgcccttcttgcaggcacagggcgaaacggaa
gcgctgcgggctctgctgcagaggctgcgggccatgccgcgagacgatcgcgccgatgcc
tattacgaccaggtattgaggctgttcggcctgggctggctgcaggggcgctttcgtttc
gagcgcaatggcaagttgctgcccgcatgggaggggaaatgttccgcatcgcttcctgta
tcgcgctga

DBGET integrated database retrieval system