KEGG   Chromobacterium violaceum: CV_2712Help
Entry
CV_2712           CDS       T00147                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase protein
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cvi  Chromobacterium violaceum
Pathway
cvi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cvi01100  Metabolic pathways
cvi01110  Biosynthesis of secondary metabolites
cvi01130  Biosynthesis of antibiotics
cvi01230  Biosynthesis of amino acids
Module
cvi_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cvi00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CV_2712 (trpC)
Enzymes [BR:cvi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     CV_2712 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: AAQ60382
LNCC_Brazil: CV2712
UniProt: Q7NUI6
Position
2935829..2936626
Genome map
AA seq 265 aa AA seqDB search
MSDILNTIIATKHQEIAAALASRPLAAVRADAEARGDRRDFVAALRAKHALGKAAVIAEV
KKASPSKGVIREDFQPAAIAESYAAHGAACLSVLTDRQYFQGDARYLEDARAACHLPALR
KDFIVDEYQVYEARAMGADCILLIAAALELPKMKALEALANELGMAVLVEVHNEEELDAA
LQLKTELVGVNNRNLRTFEVSLATTLKLLPRITDGRIAVTESGIATVEDVRLMQASGVHT
FLVGEAFMREAEPGEALSRLFFAQS
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacattctcaacaccatcatcgccaccaagcatcaggaaatcgccgccgcgctg
gccagccggccgctggccgcggttcgcgccgacgccgaggcgcgcggcgaccgccgcgac
ttcgtcgccgccctgcgcgccaaacacgcgctgggcaaggccgccgtcatcgccgaagtc
aagaaggccagcccgagcaagggcgtgatccgcgaggatttccagcccgccgccatcgcc
gagagctacgcggcccacggcgccgcctgcctgtcggtgctgaccgaccgccagtatttc
cagggcgatgcccgctacctggaagacgcccgcgccgcctgccatctgccggcgctgcgc
aaggacttcatcgtcgacgaataccaggtgtacgaagcccgcgcgatgggggccgactgc
atcctgctgatcgccgccgcgctcgagctgcccaagatgaaagcgctggaagcgctggcg
aacgagctgggcatggcggtgctggtggaagtccacaacgaagaagaactggacgccgcg
ctgcaattgaagaccgagctggtcggcgtcaacaaccgcaacctgcgcacgttcgaagtc
agcctggccaccacgctgaagctgctgccgcgcatcaccgacggccgcatcgccgtcacc
gagagcggcatcgccacggtggaggatgtgcggctgatgcaggccagcggcgtgcatacc
ttcctggtcggcgaggccttcatgcgcgaggccgaaccgggcgaggcgctgagccgcctg
ttcttcgcccaatcctga

DBGET integrated database retrieval system