KEGG   Chromobacterium violaceum: CV_2712Help
Entry
CV_2712           CDS       T00147                                 

Gene name
trpC
Definition
indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cvi  Chromobacterium violaceum
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cvi01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:cvi00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
LNCC_Brazil: 
UniProt: 
Position
2935829..2936626
Genome map
AA seq 265 aa AA seqDB search
MSDILNTIIATKHQEIAAALASRPLAAVRADAEARGDRRDFVAALRAKHALGKAAVIAEV
KKASPSKGVIREDFQPAAIAESYAAHGAACLSVLTDRQYFQGDARYLEDARAACHLPALR
KDFIVDEYQVYEARAMGADCILLIAAALELPKMKALEALANELGMAVLVEVHNEEELDAA
LQLKTELVGVNNRNLRTFEVSLATTLKLLPRITDGRIAVTESGIATVEDVRLMQASGVHT
FLVGEAFMREAEPGEALSRLFFAQS
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacattctcaacaccatcatcgccaccaagcatcaggaaatcgccgccgcgctg
gccagccggccgctggccgcggttcgcgccgacgccgaggcgcgcggcgaccgccgcgac
ttcgtcgccgccctgcgcgccaaacacgcgctgggcaaggccgccgtcatcgccgaagtc
aagaaggccagcccgagcaagggcgtgatccgcgaggatttccagcccgccgccatcgcc
gagagctacgcggcccacggcgccgcctgcctgtcggtgctgaccgaccgccagtatttc
cagggcgatgcccgctacctggaagacgcccgcgccgcctgccatctgccggcgctgcgc
aaggacttcatcgtcgacgaataccaggtgtacgaagcccgcgcgatgggggccgactgc
atcctgctgatcgccgccgcgctcgagctgcccaagatgaaagcgctggaagcgctggcg
aacgagctgggcatggcggtgctggtggaagtccacaacgaagaagaactggacgccgcg
ctgcaattgaagaccgagctggtcggcgtcaacaaccgcaacctgcgcacgttcgaagtc
agcctggccaccacgctgaagctgctgccgcgcatcaccgacggccgcatcgccgtcacc
gagagcggcatcgccacggtggaggatgtgcggctgatgcaggccagcggcgtgcatacc
ttcctggtcggcgaggccttcatgcgcgaggccgaaccgggcgaggcgctgagccgcctg
ttcttcgcccaatcctga

DBGET integrated database retrieval system