KEGG   Chromobacterium violaceum: CV_2761Help
Entry
CV_2761           CDS       T00147                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cvi  Chromobacterium violaceum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cvi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CV_2761 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CV_2761 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CV_2761 (trpA)
Enzymes [BR:cvi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CV_2761 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LNCC_Brazil: 
UniProt: 
Position
complement(2997203..2997991)
Genome map
AA seq 262 aa AA seqDB search
MSRIANCFAELAGKKALIPFITAGDPHPGLTVSLMHGLVDGGADIIELGVPFSDPMADGP
VIQRASERALKHKVGLRHVLEMVAEFRRDNATTPVVLMGYLNPLCAMGYTEFASRAKAAG
VDGVLTVDCPPEEAAELESALDAHGLDTVFLVAPTTPPSRVAEIAKLARGYVYYVSLKGV
TGAGHLDIEDVARKIAALRQQLPLPIGVGFGIRDAATAKAIAAAADAVVVGSRLVQEIEA
ATPETAREQLTRLVAELKAAIR
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgcattgctaactgttttgccgagctcgcgggcaagaaagccctgatcccgttc
atcaccgccggcgatccgcatcctggcttgaccgtgtcgctgatgcacggcctggtggac
ggcggcgccgacatcatcgagttgggcgtgccgttttccgacccgatggccgacggcccg
gtgatccagcgcgcgtccgagcgcgcgctcaagcacaaggtcggtctgcgccacgtgctg
gagatggtggccgagttccgtcgcgacaacgcaacgacgcccgtggtgctgatgggttac
ctgaatccgctgtgcgcgatgggctataccgaatttgccagccgcgccaaggcggccggc
gtggatggcgtgctgacggtggattgtccgccggaagaggccgccgagcttgagtccgcg
ctggacgcccacggcctggacaccgtgttcctggtggcgccgaccacgccgccgtcgcgg
gtggcggaaatcgccaaattggcgcgcggatacgtctattatgtgtcgctgaaaggcgtg
accggcgccggacatctggacattgaggatgtagcgcgtaaaattgctgccctcagacaa
caattgccgctgccgataggcgtgggtttcgggattcgcgacgccgcgactgccaaggcc
atcgcggccgccgccgacgcggtggtggtgggcagcaggctggtgcaggaaattgaggcg
gcgacacccgaaactgccagagagcagttaactcgtctggtggccgaattgaaggccgcc
atccgctag

DBGET integrated database retrieval system