KEGG   Chromobacterium violaceum: CV_2762Help
Entry
CV_2762           CDS       T00147                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cvi  Chromobacterium violaceum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cvi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CV_2762 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CV_2762 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CV_2762 (trpB)
Enzymes [BR:cvi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CV_2762 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
LNCC_Brazil: 
UniProt: 
Position
complement(2998003..2999133)
Genome map
AA seq 376 aa AA seqDB search
MMVALDQLKEEYARVKADPTFWQEFHHELKHYVGRPSPVYHAKRWSEQLGGAQIWFKRED
LNHTGAHKINNAIGQALLARRMGKKRVIAETGAGQHGVATATVAARYGMECVVYMGAEDV
KRQSPNVFRMKLLGATVVPVESGSKTLKDALNEAMRDWVTNVDSTFYILGTAAGPHPYPM
LVRDFVSVIGAESKIQMPEAIGRQPDVVVACVGGGSNAIGMFHPYIEVPGVRMVGVEAGG
HGVASGKHAAPISSGAPVGVLHGSKSYLMQDADGQIVETHSVSAGLDYPGVGPEHCHLKD
IGRAEYVSIDDDEALRAFHDCCHLEGIIPALESSHALAWAAKVAPSMGKDQVILVNLSGR
GDKDINTVAGLAGITL
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
ttgatggtggcgctggaccagctgaaagaagagtacgcccgagtgaaggccgatccgacg
ttctggcaggagttccatcatgaactcaagcactatgtcggccggcccagcccggtctac
catgccaagcgctggtccgagcagctgggcggcgcgcagatctggttcaagcgcgaagac
ctgaaccacaccggcgcccacaagatcaacaacgccatcggccaggcgctgctggcccgc
cgcatgggcaagaagcgggtgatcgccgagaccggcgccggccagcacggcgtggccacc
gccaccgtcgccgcgcgctacggcatggagtgcgtggtgtacatgggcgcggaagacgtg
aagcgccagtcgccgaatgtgttccgcatgaagctcctgggcgccaccgtggtgccggtg
gagtccggctccaagacgctgaaggacgcgctgaacgaagcgatgcgcgactgggtgacg
aatgtcgattccaccttctacattctcggcaccgccgccggcccgcatccttatccgatg
ctggtgcgcgatttcgtatcggtgatcggcgcggaatccaagatccagatgccggaagcg
ataggccgccagcccgatgtggtggtggcttgcgtgggcggcggctccaacgcgatcggc
atgttccatccttacatcgaggtgccgggcgtgcgcatggtgggcgtggaggcgggcggc
cacggcgtcgccagcggcaagcacgccgcgccgatttcctccggcgcgccggtgggtgtg
ctgcacggctccaagagttatctgatgcaggacgcggacggccagatcgtggagacccac
tcggtgtccgcaggcctcgattaccccggcgtggggcccgagcactgccatctgaaggac
atcggccgcgcggaatacgtgtcgatcgacgatgacgaagcgctgcgcgctttccacgac
tgctgtcatctggaaggcatcatcccggcgctggagtccagccacgcgctggcctgggcc
gccaaggtggcgccgagcatgggcaaggatcaggtgatcctggtcaatctgtccggccgc
ggcgacaaggacatcaataccgttgccggcttggccggcatcacgctgtga

DBGET integrated database retrieval system