KEGG   Chromobacterium violaceum: CV_2874Help
Entry
CV_2874           CDS       T00147                                 

Gene name
sdaA1
Definition
L-serine dehydratase (EC:4.3.1.17)
Orthology
K01752  
L-serine dehydratase [EC:4.3.1.17]
Organism
cvi  Chromobacterium violaceum
Pathway
Glycine, serine and threonine metabolism
Cysteine and methionine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:cvi01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:cvi01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:cvi00260]
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:cvi00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
LNCC_Brazil: 
UniProt: 
Position
3148670..3150070
Genome map
AA seq 466 aa AA seqDB search
MAISVFDLFKIGIGPSSSHTVGPMRAARQFISRLEKDGQLDATVRVSAEMFGSLGATGKG
HGTDVAVLLGLQGEQPDLVDTDAVDGMLAAIREQRKLKLLGKREIDFVESEHLILHKKKT
LPYHPNGMIFEAFDAAGESLSKRAYYSVGGGFVVDEAAIDAGFVPPGVTELKHPFKSAAE
LLALCQRHGKSISQIMLENELSWRSEEEVRAGLLNIWNVMQACVKRGCEREGILPGGMKV
KRRAADMHRKLLASPEAAMRDPLTVMDWVNLYALAVNEENAAGGRVVTAPTNGAAGIIPA
VMHYYARFVPGASDDGIVRFLLTAGAIGILFKLNASISGAEVGCQGEVGSACSMAAGALC
EVMGGTPEQVENAAEIGMEHNLGLTCDPVGGLVQVPCIERNAMASVKAINAVRMALRGDG
QHFVSLDRVIKTMRDTGMDMSTKYKETARGGLAINVIEVPVNIVEC
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggcaatcagtgttttcgacctgttcaaaatcggcatcggcccgtccagctcccacacc
gtgggcccgatgcgcgccgcccgccaattcatcagccgcctggaaaaggacggccagctg
gacgccactgtccgcgtcagcgccgagatgttcggttcgctgggcgccaccggcaagggc
cacggcaccgatgtggcggtgctgctgggcctgcagggcgagcaacctgacctggtcgac
accgatgcagtggacggcatgctggccgccatccgcgagcagcgcaaactgaagctgctg
ggcaagcgcgagatcgatttcgtcgaaagcgagcacctgatcctgcacaaaaagaaaacc
ctgccctaccaccccaacggcatgatcttcgaggccttcgacgccgccggcgaaagcctg
tccaagcgcgcctactattcggtaggcggcggcttcgtggtcgacgaagcggcgatcgac
gccggcttcgtcccgccgggcgtcaccgagctgaagcacccgttcaagagcgcggccgag
ctgttggcgctgtgccagcgccacggcaagagcatcagccagatcatgctggagaacgag
ctgtcctggcgcagcgaggaagaagtgcgcgccggcctgctcaacatctggaacgtgatg
caggcctgcgtgaagcgcggctgcgaacgcgaaggcatcctgccgggcggcatgaaggtg
aagcgccgcgccgccgacatgcaccgcaaactgctggcttctccggaagccgcgatgcgc
gacccgctgacggtgatggactgggtgaacctgtacgccttggccgtgaatgaagaaaac
gccgccggcggccgtgtggtgaccgctccgaccaatggcgccgccggcatcatcccggcc
gtgatgcactactacgcccgcttcgtgccgggcgccagcgacgacggcatcgtccgcttc
ctgctgaccgccggcgccatcggcatcctgttcaagctgaacgcgtccatttccggcgcc
gaagtcggctgccagggcgaagtgggttcggcttgctcgatggccgccggcgcgctgtgc
gaagtgatgggcggcacgccggaacaagtggaaaacgccgcggagatcggcatggagcac
aatctgggcctgacctgcgacccggtgggcggcctggtgcaagtgccctgcatcgagcgc
aacgcgatggcttcggtgaaggcgatcaacgcggtgcggatggcgctgcgcggcgacggc
cagcacttcgtgtcgctggaccgcgtgatcaagaccatgcgcgacaccggcatggacatg
agcaccaagtacaaggaaaccgcgcgcggcggcctggcgatcaatgtgatcgaggtgccg
gtcaacatcgtcgagtgctga

DBGET integrated database retrieval system