KEGG   Chromobacterium violaceum: CV_3119Help
Entry
CV_3119           CDS       T00147                                 

Gene name
dsbC
Definition
protein disulfide-isomerase (EC:5.3.4.1)
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
cvi  Chromobacterium violaceum
Brite
Enzymes [BR:cvi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     CV_3119 (dsbC)
Secretion system [BR:cvi02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   CV_3119 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
LNCC_Brazil: 
UniProt: 
Position
complement(3405983..3406714)
Genome map
AA seq 243 aa AA seqDB search
MNKRMKTLALSSAMLMSLAACSQAAGGNVEDVKKAFLNHFPGKQVKSVSATPVKGIYELV
VDGRQVVYVNSDASYLFVGDLIDAKNKESLTEKKMAELSKVDFNALPFQYAFKDVRGKGE
RKMAVFTDPDCPFCKKLERESLKDIDNVTIYTFLYPLTQLHPDAMRKSKQIWCSADKAAA
WTAFMRDGKPLTGPDNCDTPLDKIQALGEKMGITGTPALVFANGRMVPGAIDGGDIEQLL
NAK
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagagaatgaaaacgctggccctgtccagcgcgatgctgatgtcgctggccgcc
tgctcccaagccgccggcggcaatgtcgaggacgtgaagaaggctttcctgaatcacttt
cccggcaagcaggtgaagagcgtcagcgccaccccggtcaagggcatctacgagctggtg
gtggacggccgccaggtggtgtacgtcaacagcgacgccagctatctgttcgtcggcgac
ctgatcgacgccaagaacaaggaaagcctgaccgagaagaagatggccgagctgtccaag
gtggacttcaacgcgctgccgttccagtacgcgttcaaggacgtgcgcggcaagggcgag
cgcaagatggcggtgttcaccgatccggactgcccgttctgcaagaagctggagcgcgag
agcctgaaggacatcgacaatgtcaccatctacaccttcctctacccgctgacccagctg
catccggacgcgatgcgcaagtccaagcagatctggtgctcggccgacaaggccgccgcc
tggaccgccttcatgcgcgacggtaagccgctgaccggcccggacaactgcgacacgccg
ctggacaagatccaggcgctgggcgagaagatgggcatcaccggcacgccggcgctggtg
ttcgccaatggccgcatggtgccgggcgcgatcgacggcggcgacatcgagcagctgctg
aacgccaagtaa

DBGET integrated database retrieval system