KEGG   Chromobacterium violaceum: CV_3262Help
Entry
CV_3262           CDS       T00147                                 

Definition
oxidoreductase (EC:1.14.18.1)
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
cvi  Chromobacterium violaceum
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cvi00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    CV_3262
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    CV_3262
Enzymes [BR:cvi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     CV_3262
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
LNCC_Brazil: 
UniProt: 
Position
3549629..3550519
Genome map
AA seq 296 aa AA seqDB search
MPTLRMRKNVSTLDAGDQTLLWYARAVHDMQQRPSSDATSWQYQAAVHGTRQNPAAFTPD
QRQAWAQCQHATWFFLPWHRAYLGIFEDIVANTVARLGGPQDWALPYWNYSDPGARALPS
AFAAKQFAGLPGQNPLLVERDQGNDGKPFLDNKAVNLNCLKRKGFAGHLAPGGDSGFGGP
MRGPNHMGDSDQGQLEMVPHDMIHSDIGGLMGDPDTAALDPIFWLHHANIDRLWEIWRKM
GNANPSDPKWLNATRFFFHDAAGKAVSFAPQDVLDTANGPWHYQYDNLANPLGNVH
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgcctaccctccgcatgcgcaagaacgtatccacgctggatgccggcgaccagacgctg
ctgtggtacgcccgcgccgtgcacgacatgcagcagcgcccgtccagcgacgccaccagc
tggcaataccaggcggcggtgcacggcacgcggcagaatccggccgccttcacgccggac
cagcgccaggcctgggcgcaatgccagcacgccacctggtttttcctgccctggcaccgc
gcctacctgggcatattcgaagacatcgtcgcgaataccgtggccaggttgggcggccca
caggactgggcactgccatactggaactacagcgaccccggcgcccgcgcgcttccttcc
gccttcgccgccaaacagttcgccggcctgcccggccagaaccccctgctggtggagcgc
gatcagggcaacgacggcaagccctttctggacaacaaggcggtcaacctgaactgtctg
aaacgcaagggtttcgccgggcatttggcgccgggcggagactcgggcttcggcggaccg
atgcgcggacccaaccacatgggagacagcgaccaggggcaactggaaatggtgccccac
gacatgatacacagcgacatcggcgggctgatgggcgacccggacaccgctgcgctcgac
cccatcttctggctgcatcacgccaacatcgaccggctctgggagatatggcgcaagatg
ggcaacgccaacccctccgatccaaaatggctgaacgccacccgtttcttcttccacgac
gccgcgggcaaggcggtttctttcgcgccccaggacgtgttggataccgccaacggccct
tggcactaccagtacgacaatctcgccaatccgctgggcaacgtccactag

DBGET integrated database retrieval system