KEGG   Chromobacterium violaceum: CV_3304Help
Entry
CV_3304           CDS       T00147                                 

Gene name
aceB
Definition
(RefSeq) malate synthase (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
cvi  Chromobacterium violaceum
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:cvi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CV_3304 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CV_3304 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    CV_3304 (aceB)
Enzymes [BR:cvi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     CV_3304 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
LNCC_Brazil: 
UniProt: 
Position
3598025..3599620
Genome map
AA seq 531 aa AA seqDB search
MAVNLPQGVEVLADITPAYAEILTPEALAFVAKLHRRFEPTRRERIAARAARQAELDAGK
LPDFLPETAAVRAGDWKIAPLPADLLDRRVEITGPVERKMMINALNSGAKSFMADFEDSN
CPSWDNQIAGQINVRDAYRKTISFQSPEGKQYRLNDTVATLLLRPRGWHLMEKHVKVDGE
IVSGSLFDFGLSFFHNIHYLRERGSATYYYLPKMESHLEARLWNQVFVFAQDELNIPQGT
IKATVLIETILAAFEMDEILYELREHSAGLNAGRWDYIFSCIKKFKQNRDFCLANRALIT
MTVPFMRAYALLLLKTCHHRDAPAIGGMAALIPIKNDAAANEKALAGVKADKERDATDGY
DGGWVAHPGLVPIANAAFTAALGDAPNQIAKQRPDVQVSAADLLNFQPEAPITEAGLAMN
INVGIQYLGAWISGNGCVPIHNLMEDAATAEISRSQIWQWIRSPKGVLDDGRKVTVELFR
ELQAREVAKLQAEYGARWTRQYEDAARMFDLLTTSDDFVEFLTLPGYEYIA
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcaatctcccgcagggcgtggaagttctcgccgacatcactccggcctacgcc
gaaatcctcacccccgaggcgctggccttcgtcgccaagctgcaccgccgcttcgagccg
acgcggcgcgagcgcatcgccgcccgcgccgcgcgccaggccgagctggacgccggcaag
ctgccggacttcctgccagaaaccgccgccgtgcgcgccggcgactggaagatcgcgccg
ctgccggcggacttgctggaccgccgcgtcgaaatcaccggcccggtggagcgcaagatg
atgatcaacgcgctgaactccggcgccaagagcttcatggccgacttcgaggactccaac
tgcccgagctgggacaaccagatcgccggccagatcaatgtccgcgacgcctaccgcaag
accatttccttccagagcccggaaggcaagcagtaccggctgaacgacaccgtcgccacc
ctgctgctgcgcccgcgcggctggcacctgatggaaaagcacgtcaaggtggacggcgag
atcgtgtccggcagcctgttcgacttcggcctgtcgttcttccacaacatccattacctg
cgcgagcgcggcagcgccacctattactacctgcccaagatggaaagccatctggaagcg
cggctgtggaatcaggtgttcgtgttcgcccaggacgagctgaacatcccgcagggcacg
atcaaggccacggtgctgatcgagaccatcctcgccgccttcgagatggacgaaatcctc
tacgagctgcgcgagcattccgccggcctcaacgccggccgttgggactacatcttcagc
tgcatcaagaagttcaagcagaaccgcgacttctgcctggccaaccgcgcgctgatcacg
atgaccgtgcccttcatgcgcgcctacgcgctgctgctgctgaaaacctgccaccaccgc
gacgcgccggccatcggcggcatggcggcgctgattccgatcaagaacgacgccgccgcc
aatgaaaaggcgctggccggcgtgaaggcggacaaggagcgcgacgccaccgacggctac
gacggcggctgggtggcccacccaggcctggtgccgatcgcaaacgccgccttcaccgcc
gcgctgggcgacgcgcccaaccagatcgccaagcagcgcccggatgtgcaggtgagcgcc
gccgacctgctgaacttccagccggaagcgccgatcaccgaagcgggtctcgccatgaac
atcaacgtcggcatccagtacctgggcgcctggatttccggcaacggctgcgtgcccatc
cacaacctgatggaagacgccgccaccgccgagatctcgcgctcgcagatctggcagtgg
atacgctcgcccaagggcgtgctggacgacggccgcaaggtgacggtggagctgttccgc
gagctgcaggcccgcgaagtggccaagctgcaagccgaatacggcgcgcgctggacccgc
caatacgaggacgcggccaggatgttcgacttgctcaccacctcggacgacttcgtcgag
ttcctgacgctgccgggctacgaatacatcgcctga

DBGET integrated database retrieval system