KEGG   Chromobacterium violaceum: CV_3397Help
Entry
CV_3397           CDS       T00147                                 

Definition
stearoyl-CoA 9-desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
cvi  Chromobacterium violaceum
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cvi00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    CV_3397
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    CV_3397
Enzymes [BR:cvi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     CV_3397
Lipid biosynthesis proteins [BR:cvi01004]
 Desaturase
  First
   CV_3397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
LNCC_Brazil: 
UniProt: 
Position
complement(3691648..3692865)
Genome map
AA seq 405 aa AA seqDB search
MSLVTGRIEYMNLNWLNGLLDLPWWGNIIAALILTHITIASVTIFLHRHQAHRALDLHPI
PSHFFRFWLWLTTGMVTKQWAAIHRKHHARCETQEDPHSPQVLGIKKVLWEGAELYRAAC
KDQSIMDKFGHGTPDDWLERNVYSKHNAKGIVLMLLIDLALFGPIGLSIWAVQMVWIPFW
AAGVINGLGHYWGYRNFENEDASTNLVPWGILVGGEELHNNHHTFGTSAKLSYKWYEFDI
GWMYIRMLEICGLAKVRKVAPQLAHDPSRPQLDLEHLQAIIANRYAIAARYARELKAECR
AELAKLSLPELPQVNLPRKMKVWLKQDAKDLPECERDQLARILEQSHVLATIYNMRQELT
RLWERSNLTREQLLHELQDWCARAEASGIAALQRFSLNLRQTALA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
ttgtctctagttactggacgcatcgaatacatgaacctgaactggctcaacggtctgctg
gatctgccttggtggggcaatatcatcgccgccctgatcctgacccacatcaccattgcc
tcggtcaccattttcctgcatcgccaccaggcccaccgcgcgctggacctgcacccgatt
cccagccatttcttccgcttctggctgtggctgaccaccggcatggtcaccaagcagtgg
gcggccatccaccgcaagcaccacgcgcgctgcgaaacgcaggaagacccgcatagcccg
caggtgctcggcatcaagaaggtgctgtgggaaggggccgagctgtatcgcgccgcctgc
aaggaccagtccatcatggacaagttcggccacggcacgccggacgactggctggagcgc
aacgtttacagcaagcacaacgccaagggcatcgtgctgatgctgctcatcgacctggcg
ctgttcgggcccatcggcctgtcgatctgggcggtgcagatggtgtggatcccgttctgg
gcggccggcgtgatcaacggcctcggccattactggggctaccgcaatttcgagaacgag
gacgcctccaccaacctggtgccctggggcatcctggtcggcggcgaggagctgcacaac
aaccaccacaccttcggcacctcggccaagctgtcgtacaaatggtacgagttcgacatc
ggctggatgtacatccgcatgctggaaatctgcggcctggccaaggtgcgcaaggtggcg
ccgcagctggcccacgatccgtcccgcccgcagctggacctggaacaccttcaggccatc
atcgccaaccgctacgcgatcgccgcgcgctacgcccgcgaactgaaggccgagtgccgc
gccgaactggccaagctcagcctgcccgagctgccgcaggttaatctgccgcgcaagatg
aaggtatggctgaagcaggacgccaaggacctgcccgagtgcgagcgcgaccaactggcc
cgcatcctggagcagagccacgtgctcgccaccatctacaacatgcgccaggagctgacc
cgcctgtgggagcgctccaacctgacccgcgagcaactgctgcatgagctgcaggactgg
tgcgcgcgcgccgaggcatccggcatcgccgctttgcagcgtttctcgctgaacctgagg
cagaccgccttggcttga

DBGET integrated database retrieval system