KEGG   Chromobacterium violaceum: CV_3490Help
Entry
CV_3490           CDS       T00147                                 

Definition
glucan 1,4-a-glucosidase (EC:3.2.1.3)
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
cvi  Chromobacterium violaceum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cvi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CV_3490
Enzymes [BR:cvi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     CV_3490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
LNCC_Brazil: 
UniProt: 
Position
3783551..3786175
Genome map
AA seq 874 aa AA seqDB search
MKHPSLIRPALLGALIAALFAPAVQAGEAFGSPGGAPVRGPAAKSFVGTAVNSPSRVYFT
GYRGIVSEVYYPLLDTPESVDLQFLVGDAGRTFVDEEKRQAYSASQSDKRTMSWVASTGN
AGHNWQISKRIFADPNRDALVQRVTFTALNGHTVGDFNLYALFKPYLDNSGSGNSAQTVA
VAGGYALAASRNSRASALMASLPWKTVNGQAMLSSGFVGQSDGWTDLIGSGDNTMNWTYG
SATNGNVAQTGWLDLGDPTATSVSFDMVLAFGKNQGDAVNAAAAALGSDLSAAQQQYDNA
WHAYAAGLSNQGGLADDRYYLAAMTLKTMQDKSNGAMIAGIGTPWGETQGDTNQGGYHLV
WPRDLFKFANALYTAGDAATAASVVNYLFNTLQQTSDCGAAEYNAPGCAAGYSRVGRFPQ
NAWISGWPYWQGTQMDEQAMPILLAWRLGPAVSNPLWPKIKQTADYIVATGPWSYQERWE
ENAGYSPSTIAAEIAGLVAAADIARANGDDASAGRYLSAADYWQQNVATWTYTTSGSFGN
GSYYVRINPANRSGSGADRASFNPAAGPDTPQTLTVKNGGGSHDARRVVDGGFLELVRMG
VKRADDPTIVNTMAVFDSVLGQNLALPGAPALPANAWFRYNFDGYGEHNDGRDFDGTGAG
RLWPIFTAERGMYEIARQGAGSAGQPYFATLKLLATPEGMLPEQVWSNSATLPDGWAVTT
PAGYRPGSATKSMGPLNWAMGEYISLLASIGAGRVVDIPQVVCARYNNCRAAPKSGEVAV
AINASATTQWGQQVYVTGNARALGNWNTDLGIPLDAAAYPSWKNGANLPAGQQIAYKYYR
KNADGSVSWENLAGNRSLQTPASGSLSLNDQVNW
NT seq 2625 nt NT seq  +upstreamnt  +downstreamnt
atgaaacacccgtccctgatccgccccgccctgctgggcgccctgatcgccgccctgttt
gcgcccgccgtccaggctggggaggcattcggctcgcccggcggcgcgccggtgcgcggc
ccggcagccaagtccttcgtcggcaccgcggtcaacagcccttcccgcgtctacttcacc
ggctaccgcggcatcgtgtccgaggtgtactacccgctgctggacacgccagaatcggtg
gatctgcaattcctggtcggcgacgccggccgcaccttcgtcgacgaggagaaacgccag
gcctactccgccagccagagcgacaagcgcacgatgagctgggtcgccagcaccggcaac
gccggccacaactggcaaatcagcaagcgcatcttcgccgatcccaaccgcgacgcgctg
gtgcagcgcgtcaccttcaccgcgctgaacggccatacggtcggcgacttcaatctgtac
gcgctgttcaagccctatctggacaattcgggcagcggcaacagcgcgcagaccgtggcc
gttgccggcggctacgcgctggcggccagccgcaatagccgcgcgtcggcgctgatggcc
agcctgccgtggaagaccgtcaacggccaggccatgctgtccagcggcttcgtcggccag
agcgacggctggaccgacctgataggcagcggcgacaacacgatgaactggacctacggc
tcggccaccaacggcaacgtcgcccaaaccggctggctggacctgggcgatccaaccgcg
accagcgtgtctttcgacatggtgctggccttcggcaagaatcagggcgacgccgtcaac
gccgcggccgcggccctcggcagcgacctttccgccgcgcagcagcagtacgacaacgcc
tggcacgcctacgccgccggcctgtccaaccagggcggcctggcggatgaccgctactac
ctggcggcgatgacgctgaaaaccatgcaggacaagagcaacggcgcgatgatcgccggc
atcggcacgccgtggggcgagacccagggcgacaccaaccagggcggctaccacctggtg
tggccgcgcgacctattcaagttcgccaacgccctctacaccgccggcgacgccgccacc
gccgcctcggtggtgaactacctgttcaacacgctgcagcaaaccagcgattgcggcgcg
gcggaatacaacgcgcccggctgcgccgccggctacagccgcgtcggccgcttcccgcaa
aacgcctggatcagcggctggccgtactggcagggcacgcaaatggacgagcaggcgatg
cccatcctgctggcctggcgtctggggccggcggtgtccaatccgctgtggcccaagatc
aagcagaccgccgactacatcgtcgccaccgggccatggagctaccaggagcgctgggag
gagaatgccggctactcgccgtccaccatcgccgccgaaatcgccggactggtggccgcc
gccgacatcgcccgcgccaacggcgacgacgccagcgccggccgctacctgtccgccgcc
gactactggcagcaaaacgtcgcaacctggacctacaccaccagcggcagcttcggcaac
ggcagctactatgtccggatcaacccggccaaccgctccggaagcggcgccgaccgcgcc
agcttcaatccggcggcggggccggacacgccgcaaacgctgacggtcaagaacggcggc
ggcagccacgacgcccgccgcgtcgtcgacggcggcttcctggaactggtgcggatgggc
gtcaagcgcgccgacgaccccaccatcgtcaacaccatggccgtgttcgacagcgtgctg
ggccagaacctggcgctgcccggcgcgcctgcgctgccggccaacgcctggttccgctac
aatttcgacggctacggcgagcataacgacggccgcgacttcgacggcacgggcgcgggc
cggctgtggccgatcttcaccgccgagcgcggcatgtacgagatcgcccgccagggcgct
ggcagcgccggccagccctatttcgccacgctgaagctgctggccacgccggaaggcatg
ttgccggaacaagtgtggtccaacagcgcgacgctgccggacggctgggccgtgaccacg
ccggccggctaccggccaggcagcgccaccaagtcgatgggaccgttgaactgggcgatg
ggcgaatacatcagcctgctggcctcgatcggcgccggccgggtggtcgacatcccgcag
gtggtctgcgcgcgctacaacaactgccgcgccgcgcccaagtccggcgaggtggcggtg
gccatcaacgccagcgctaccacccaatggggccagcaagtctatgtcaccggcaacgcc
cgcgcgctgggcaactggaacaccgacctcggcatcccgctggacgcggccgcctatccg
tcgtggaaaaacggcgccaacctgccggccggccagcaaatcgcctacaagtattaccgc
aagaacgccgacggcagcgtgagctgggaaaacctggccggcaaccgcagtctgcagaca
cccgccagcggcagcctcagcctgaatgatcaggtgaactggtga

DBGET integrated database retrieval system