KEGG   Chromobacterium violaceum: CV_3526Help
Entry
CV_3526           CDS       T00147                                 

Definition
hypothetical protein
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
cvi  Chromobacterium violaceum
Brite
Enzymes [BR:cvi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     CV_3526
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
LNCC_Brazil: 
UniProt: 
Position
3833726..3835012
Genome map
AA seq 428 aa AA seqDB search
MKPKYSPATAIDAVTMQRILALILLSCSSLISAGAPAKPAYQGASYAPGPRPVSAKQLEA
LGRQLFFDRSLSASGKMSCASCHSPDHAYGPPNGLPAQLGGRDGKQPGTRAVPSLRYLQT
VPPFSEHFHDNDGNDSEDAGPTGGYTWDGRADSAHAQAAMPLLAANEMANGTPAAVVGKL
RRSSSAARFRSLFGDDIFSRPAQAFDKAALALEVFQQNPREFYPYDSKYDAYLRGQAKLS
AQEARGLKAFNDPGKGNCASCHISQRSEGGAFPQFSDYGHIAVGAPRNSQLAANRDSHYF
DLGLCGPARTDFKNRADYCGLFRTPSLRNVATRKVFFHNGGFHDLRQVLRFYAERDTRPE
KWYPKGKDGKVAKFDDLPARYQANVNMEAPFGGKAGGKPMFNERDIDDMLAFLKTLNDGY
KPARHGKS
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaagccgaagtacagtcccgccaccgcaatcgacgccgtcaccatgcaacgaatcctc
gcgctcatcctgctgtcctgctccagcctcatctcggccggcgcgcccgccaaaccagct
tatcaaggcgccagctacgcgccgggcccgcgccctgtcagcgccaagcagctggaagcg
ctcggccgccagctgttcttcgaccgctcgctgtcggcctccggcaagatgtcctgcgcc
agttgccacagtcccgaccatgcctatggcccgcccaacggcctgcccgcgcaactgggc
ggccgggatggcaagcagcccggcacccgcgccgtgccgtccttgcgctacttgcagacc
gtgccgcccttcagcgaacacttccacgacaacgacggcaacgacagcgaggatgccggt
cccaccggcggctacacctgggacggccgcgccgactccgcccacgcccaggccgcgatg
ccgctgctagccgccaacgagatggccaacggcacgccggcagcagtcgtcggcaagctg
cggcgctcatcttccgccgcgcgcttcaggagcctgttcggcgacgacatcttcagccgc
cccgcgcaggctttcgacaaggccgccctggcgctggaagtgttccagcagaatccgcgc
gagttctatccctatgacagcaaatacgacgcctacctgcgtggccaggccaagctgagc
gcgcaggaggcacgcggcctgaaagccttcaacgatccgggcaaaggcaactgcgcgtcc
tgccacatcagccagcgcagcgaaggcggcgccttcccgcaattcagcgactacggccat
atcgccgtcggcgcaccgcgcaattctcagctcgccgccaaccgcgacagccattacttc
gaccttggcctgtgcgggccggcgcgcaccgacttcaagaaccgcgccgactactgcggc
ctgttccgcacccccagcctgcgcaacgtcgccacccgcaaggttttcttccacaacggc
ggcttccacgatctgcgccaggtgctgcgcttctatgccgaacgggacacgcgtccggaa
aagtggtatccgaaaggcaaggacggcaaagtggccaagttcgacgatctgccggcgcgc
tatcaggccaacgtcaacatggaggcgccattcggcggcaaggcgggcggcaagccgatg
ttcaacgagcgcgacatcgacgacatgctggcttttctgaaaacgctgaacgacggctac
aagccggcgcgccacggcaaaagctga

DBGET integrated database retrieval system