KEGG   Chromobacterium violaceum: CV_3680Help
Entry
CV_3680           CDS       T00147                                 

Gene name
pcm1
Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
cvi  Chromobacterium violaceum
Brite
Enzymes [BR:cvi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     CV_3680 (pcm1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
LNCC_Brazil: 
UniProt: 
Position
3981235..3981903
Genome map
AA seq 222 aa AA seqDB search
MAAPLTPNAQAYGMLSERTRRRMSDRLRQHGISDERVLSAMHEVPRHLFVDQALATRAYD
DVSLPIGHGQTISQPLTVARMTELLIQGRQPGKILEVGTGCGYQTAVLLKTGAEVYSIER
LGAILDQARRNLRAAKLVHARLVHGDGNAGLPEAAPFDGIIITAAARAVPAPLVDQLAEG
GRMVLPLGDAEQHLWLLEKTAQGLQKTRLDPVKFVPLLGGRG
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaccgctgaccccgaacgcccaggcctacggcatgctttccgagcgcacgcgc
cgccgcatgagcgaccgcctgcgccagcacggcatcagcgacgagcgggtgctgtcggcg
atgcacgaggtgccgcgccacctgttcgtcgaccaggcgctggccacccgcgcctatgac
gacgtgtcgctgcccatcggccatggccagaccatctcccagccgctgacggtggcgagg
atgaccgaattgctgatccagggccggcaacccggaaagatcctggaggtcggcaccggc
tgcggctaccagacggcggtgctgctgaaaaccggcgccgaagtctattcgattgaacga
ctcggcgcgattcttgaccaagcaagacgcaatctgcgcgccgccaagctggtccacgcc
cggctggtgcacggcgacggcaacgcgggcctgcccgaggccgcgccgttcgacggcatc
atcatcaccgccgccgcgcgcgcggtgccggcgccgctggtggaccagctggccgagggc
ggccggatggtgctgccgcttggcgacgccgagcaacacctgtggctgctggaaaaaacg
gcgcaaggcctgcagaagacccggctggatccggtcaagttcgttccgctgctgggcgga
cgcggctga

DBGET integrated database retrieval system