KEGG   Chromobacterium violaceum: CV_3735Help
Entry
CV_3735           CDS       T00147                                 

Gene name
tesA
Definition
acyl-CoA thioesterase (EC:3.1.2.20)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
cvi  Chromobacterium violaceum
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:cvi01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
LNCC_Brazil: 
UniProt: 
Position
4033281..4033877
Genome map
AA seq 198 aa AA seqDB search
MRSIVCKMLFPLLLLWQLPALAATVLVFGDSLSAGYGLAPGQGWAALLARDLSPRHKVVN
ASVSGETSAGGLSRLPDALARHQPDVLVLELGANDGLRGLPMADMRRNLQRMIDLAQARK
AKVLLVGMALPPNYGPRYGAEFRAVYDDLARRNRLAYVPLLVEGFAGDLGAFQPDGLHPR
AEKQATMMRTVKAKLPVK
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcgctctatcgtctgcaaaatgctgttccctttgttgctgctgtggcagctgcccgcc
ctggccgccaccgtgctggtgttcggcgacagcctgtccgccggctacggcctggccccg
ggccagggatgggcggcgctgctggcgcgcgacctctcgccccggcacaaggtggtcaac
gccagcgtgtccggcgaaaccagcgccggcggcctgtccaggctgcccgacgcgctcgcc
cgccaccagcccgacgtgctggtgctggaactcggcgccaacgatggcctgcgcggcctg
ccgatggctgacatgaggcgcaacctgcagcggatgatagacctggcccaggcgcgcaag
gccaaggtgctgctggtgggcatggcgctgccacccaactatggcccccgctacggcgcc
gagttccgcgccgtttatgacgatttggcccgccgcaaccgcctggcctacgtgccgctg
ctggtcgagggcttcgccggcgacctcggcgccttccagcccgacggcctgcatccccgc
gcggagaagcaggccaccatgatgcgcacggtcaaggcaaaactgccagtgaaataa

DBGET integrated database retrieval system