KEGG   Chromobacterium violaceum: CV_3735Help
Entry
CV_3735           CDS       T00147                                 

Gene name
tesA
Definition
acyl-CoA thioesterase (EC:3.1.2.20)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
cvi  Chromobacterium violaceum
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:cvi00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    CV_3735 (tesA)
Enzymes [BR:cvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     CV_3735 (tesA)
   3.1.2  Thioester hydrolases
    3.1.2.-  
     CV_3735 (tesA)
Lipid biosynthesis proteins [BR:cvi01004]
 Fatty acid synthase
  Component type
   CV_3735 (tesA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
LNCC_Brazil: 
UniProt: 
Position
4033281..4033877
Genome map
AA seq 198 aa AA seqDB search
MRSIVCKMLFPLLLLWQLPALAATVLVFGDSLSAGYGLAPGQGWAALLARDLSPRHKVVN
ASVSGETSAGGLSRLPDALARHQPDVLVLELGANDGLRGLPMADMRRNLQRMIDLAQARK
AKVLLVGMALPPNYGPRYGAEFRAVYDDLARRNRLAYVPLLVEGFAGDLGAFQPDGLHPR
AEKQATMMRTVKAKLPVK
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcgctctatcgtctgcaaaatgctgttccctttgttgctgctgtggcagctgcccgcc
ctggccgccaccgtgctggtgttcggcgacagcctgtccgccggctacggcctggccccg
ggccagggatgggcggcgctgctggcgcgcgacctctcgccccggcacaaggtggtcaac
gccagcgtgtccggcgaaaccagcgccggcggcctgtccaggctgcccgacgcgctcgcc
cgccaccagcccgacgtgctggtgctggaactcggcgccaacgatggcctgcgcggcctg
ccgatggctgacatgaggcgcaacctgcagcggatgatagacctggcccaggcgcgcaag
gccaaggtgctgctggtgggcatggcgctgccacccaactatggcccccgctacggcgcc
gagttccgcgccgtttatgacgatttggcccgccgcaaccgcctggcctacgtgccgctg
ctggtcgagggcttcgccggcgacctcggcgccttccagcccgacggcctgcatccccgc
gcggagaagcaggccaccatgatgcgcacggtcaaggcaaaactgccagtgaaataa

DBGET integrated database retrieval system