KEGG   Chromobacterium violaceum: CV_3901Help
Entry
CV_3901           CDS       T00147                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cvi  Chromobacterium violaceum
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cvi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CV_3901 (galU)
   00052 Galactose metabolism
    CV_3901 (galU)
   00500 Starch and sucrose metabolism
    CV_3901 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    CV_3901 (galU)
Enzymes [BR:cvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CV_3901 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
LNCC_Brazil: 
UniProt: 
Position
complement(4210760..4211632)
Genome map
AA seq 290 aa AA seqDB search
MKKITKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAIAAGMTELIFITGRN
KRSIEDHFDKAYELETELEYKNKQKLLQLVQEIIPPSVSCIYIRQTEALGLGHAVLCARP
VVGDEPFAVILADDLIEGAPGAMEQMVRLFDETHSSILGVETVAPEETGSYGIVKVAANA
QGHQRVEHIVEKPRPEEAPSNLAVVGRYILTPRIFDKLVNTAAGAGGEIQLTDGIAALMK
NEPVLALPFKGTRYDCGSKLGYLKATVNYGLKHNEVAGDFAAFLRELKLD
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaatcaccaaagcggtatttccggtggccggtctgggcacccgtttcctgccc
gccaccaaggccagtcccaaggagatgctgcccgtcgtcgacaagccgctgatccagtac
gcggtggaggaggcgatcgccgccggcatgaccgagctgatcttcatcaccggccgcaac
aagcgttcgatcgaggaccatttcgacaaagcctacgagctggagaccgagctcgaatac
aagaacaagcagaagctgctgcagctggtgcaggaaatcattccgccttctgtcagctgc
atctatatccgccagaccgaggcgctgggcctgggccatgccgtgctgtgcgcgcgcccg
gtggtgggagacgagccgtttgcggtgattctggccgacgatttgatcgaaggcgcgccg
ggcgcgatggagcagatggtgcgcctgttcgacgagacccactcgtccatcctgggcgtg
gagaccgtggcgccggaagagaccggctcctatggcatcgtcaaggtggccgcaaatgcg
caaggccatcagcgcgtagagcacatcgtggagaagccgcgcccggaagaggcgccgtcc
aatctggccgtggtcggccgctatatcctgaccccgcgcatcttcgacaagctggtcaac
accgcagccggcgccggcggcgaaatccagctgaccgacggcatcgccgcgctgatgaag
aacgagccggtgctggccttgcccttcaagggcacccgctacgattgcggctccaagctg
ggctatctgaaggccacggtcaactatggtttgaagcacaatgaggtggccggcgatttc
gccgccttcctgcgcgagctgaagctcgactga

DBGET integrated database retrieval system