KEGG   Chromobacterium violaceum: CV_3959Help
Entry
CV_3959           CDS       T00147                                 

Definition
asparagine synthetase B
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
cvi  Chromobacterium violaceum
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:cvi00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
LNCC_Brazil: 
UniProt: 
Position
complement(4279442..4281430)
Genome map
AA seq 662 aa AA seqDB search
MCGIAGALLDRHAHDGDVAEARRMILRQTHRGPDGLAARRVGPALLASSRLAIVDVANGS
QPFSDESRAIHAVFNGEIYNHLELRENLSRRGHSLSGGSDGEVIVHLYEEYGTDCFQWLD
GQFAIAIFDSRDDSLHLARDRMGICPLHWARLDGALYFSSEIKGLLAVAGMPRRAEPRAM
LQLAYFGAVCAPLTPFGGIHQLPAAHRLSFRAGRLEIGRYWSLDFPLAGEHARLSEAQAA
EGLAARLERAVASHAQGEFEPTCFLSGGIDSAVIAALLQRRSQASIAAFCAASEHGRMDE
GGAAARTAEWLGVDLKRVRIDEAGIADAFPRLIWHGETPVISTEASALMRLAGEAGKRSK
IVLTGEGADEAFAGYLAFRQYRQLGALTGRGLSPLRTMVRPWLRGHYGSECLLPGEDRLG
VLAEHFGCVPAQAYEWEFYREALTPLFSPELRAMAAAGGCWDGFEFDRGAVRGRHWLDRS
LYVSYQVMLPNYLLGAHGDRIYAAHSVEGRYPFLDRALVEYAAALDPALKLRRGREKHIL
RVAAARWLPDEVAWRPKTRFVMPFGTPFVGPRAAPLYAELLSPGKLAEYGYFDPERVRSL
FRALASPPSAGGKARRYLERLALGLGATFVVSAQLWHHLHLADGGSAVSGEAARRSAPAT
IA
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaatcgcgggagcgctgctggaccgccatgcgcacgatggcgacgtggccgag
gccaggcggatgatactgcgccagacccatcgcggcccggacggcctggcggcgcggcgc
gtcggcccggcgttgctggcctcgtccaggctggccatcgtcgatgtcgccaacggcagc
cagcctttcagcgacgagagccgcgccatccacgccgtgttcaacggcgaaatctacaac
cacctcgaattgcgcgaaaacctgtcgcgccgcggccatagcctgtcaggcggcagcgac
ggcgaagtcatcgtccacctgtacgaggagtacggaacggattgcttccaatggctggac
ggccagttcgccatcgccatcttcgactcccgcgacgactcgctgcatctggcgcgcgac
cgaatgggcatctgtcccttgcattgggcgcggctggacggcgcgctgtatttcagctcc
gagatcaagggcctgctggcggtggccggtatgccgcgccgggcggagccgcgcgcgatg
ctgcagctcgcttatttcggcgccgtctgcgcgccgctgacgcccttcggcggcatccat
caattgcccgccgcccacaggctcagcttccgcgccggacggctggagattggccgttac
tggtcgctggattttccgctggccggcgagcatgccaggctgagcgaggcgcaggcggcc
gaggggctggcggctcggctggaacgggccgtggccagccacgctcagggcgagttcgag
ccgacctgctttctcagcggcggcatcgattcggccgtgatcgccgcgctgctgcagcgc
cgcagccaagcatccatcgccgctttctgcgccgcatccgaacatgggcggatggacgag
ggcggcgccgcggcccgcaccgccgagtggctgggcgtggatttgaagcgggtccgcatc
gacgaggcgggcatcgccgacgccttcccccggctgatctggcatggcgagacgccggtg
atctccaccgaggcgtcggccctgatgcgcttggccggcgaagccggcaagcgttcgaag
atcgtgctcaccggcgagggcgccgacgaggctttcgccggctatctggccttccgccag
taccggcagctgggcgcgctgacggggcgcggcctctcgccgttgcggacgatggtccgg
ccgtggctgcgcggccattacggctcggaatgcctgttgccgggggaggaccggctgggc
gtgttggccgagcatttcggctgcgtgccggcgcaggcctatgagtgggagttctaccgc
gaggcgttgacgccgctgttttccccggagctgagggcgatggcggcggcgggcggctgc
tgggacggcttcgagttcgaccgcggcgcggtgcgcggccgccattggctggaccgctcg
ctgtacgtgtcctaccaggtgatgctgcccaattatctgctgggcgcgcatggcgaccgc
atctatgccgcccattcggtcgaggggcgctacccctttctggatcgtgcgctggtcgag
tacgcggcggcgctggatccggcgctgaagctgcgccgcgggcgggagaaacacatcctg
cgcgtcgccgcggcgcgctggctgcctgacgaggtggcctggcggccgaaaacccgtttc
gtgatgcccttcggcacccctttcgtcggcccgcgcgccgcgccgctgtacgcggagctg
ctgtcgccgggcaagctggccgagtacggctatttcgatccggagcgagtgcgttcgctg
ttccgggcgctggcctcgccgccgtctgccggcggcaaggcccggcgctatctcgagcgg
ctggcgctgggcctgggcgccaccttcgtggtcagcgcccagctctggcaccacctgcat
ttggccgatggcggatcggccgtgtccggagaggcggcgcggcgctccgcgccggcgacc
atcgcatga

DBGET integrated database retrieval system