KEGG   Chromobacterium violaceum: CV_4013Help
Entry
CV_4013           CDS       T00147                                 

Gene name
rfbC
Definition
dTDP-6-deoxy-D-glucose-3,5 epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
cvi  Chromobacterium violaceum
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cvi00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    CV_4013 (rfbC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CV_4013 (rfbC)
Enzymes [BR:cvi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     CV_4013 (rfbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
LNCC_Brazil: 
UniProt: 
Position
4339325..4339867
Genome map
AA seq 180 aa AA seqDB search
MKVIDTEISAVKIIEPQIFGDERGFFFESFNQQRFEQAVGHAVDFVQDNHSRSGKNVLRG
LHYQLDPHPQGKLVRVVSGAVFDVAVDIRPGSETFGQWVGVELSAANKRQLWIPAGFAHG
FLTLSDDVEFLYKTTDYWHPELERTLAWDDPDLAIAWPLSDAPTLSAKDQTGASFSSLPR
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcattgataccgagatctccgcggtcaagatcatcgagccccagatatttggc
gatgagcgcggttttttcttcgaaagcttcaatcagcagcgtttcgaacaggctgtcggc
catgcggtcgacttcgtgcaggacaaccacagccgctccggcaaaaatgtcctgcgcggg
ctgcactaccagctcgatccgcatccgcagggaaagctggtgcgcgtcgtgtcaggcgca
gtattcgacgtcgcagtcgacatccgtcccggttccgagaccttcggccaatgggtcgga
gtagagctcagcgccgccaacaagcgtcagctgtggattcccgccggcttcgcccacggc
ttcctcacgctgagcgacgatgtggagttcctgtacaagaccaccgattactggcatccg
gagctggaacgcaccctcgcctgggatgacccggacctggcaatcgcctggccgctgagc
gacgcgccgacgctgtcagccaaggaccagaccggcgcctccttctcctcgctgccgcgc
tga

DBGET integrated database retrieval system