KEGG   Chromobacterium violaceum: CV_4062Help
Entry
CV_4062           CDS       T00147                                 

Gene name
mutM
Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
cvi  Chromobacterium violaceum
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:cvi03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
LNCC_Brazil: 
UniProt: 
Position
4392630..4393442
Genome map
AA seq 270 aa AA seqDB search
MPELPEVETTRRGVEPHLEGRTLLGAVVRNPSLRWPVPPDLSERVAGEKVLAVRRRAKYL
LLECESGTLLIHLGMSGSLRVMPAGAPPQKHDHLDLLLGEQVLRFRDPRRFGAVLWHLGP
VEMHPLLQALGPEPLSDAFDGAALHQAIRRRGSPIKLAIMDNHVVVGVGNIYANESLFHA
GISPARAACDLSRADCDRLAAEIKAVLRRAIDAGGSTLRDFVDSEGKPGYFQQTYMVYNR
QEEPCRLCGTPIRQIRQGQRSTYYCPLCQP
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaactgccagaagtcgaaactacccgccgcggcgtcgagccgcacctggaaggc
cgaaccctgctcggcgccgtcgtccgcaatcccagcctgcgctggccggtgccgcccgac
ctgtccgagcgcgtcgccggggaaaaggtgctggccgtgcgccgccgcgccaaatacctg
ctgctggaatgcgaaagcggcaccctgctgatccacctgggcatgtccggcagcctgagg
gtgatgccggccggcgcgccgccgcaaaaacacgatcacctggacttgctgttgggcgaa
caggtgctgcgcttccgcgatccgcggcgcttcggcgcggtgctgtggcatctcggcccc
gtcgagatgcacccgctgctgcaggcgctggggccggagccgctgtccgacgccttcgac
ggcgcggcgctccatcaggccatccgccgccgcggcagtccgatcaagctggccatcatg
gacaaccacgtggtggtcggcgtcggcaacatctacgccaacgaatcgctgttccacgcc
ggcatcagtcccgcccgcgcggcctgcgatctgtcccgcgccgactgcgaccgcctcgcg
gccgagatcaaggccgtgctgcggcgcgcgatcgacgccggcggcagcacgctgcgcgat
ttcgtcgacagcgagggcaaacccggctacttccagcagacctatatggtgtacaaccgc
caggaagagccctgccgcctctgcggcacgccgatccgccaaatccgccagggccagcgc
agcacttactattgcccgctgtgccagccgtga

DBGET integrated database retrieval system