KEGG   Chromobacterium violaceum: CV_4135Help
Entry
CV_4135           CDS       T00147                                 

Definition
hypothetical protein
Orthology
K13590  
diguanylate cyclase
Organism
cvi  Chromobacterium violaceum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
LNCC_Brazil: 
UniProt: 
Position
4474917..4476674
Genome map
AA seq 585 aa AA seqDB search
MDNTARLEHIIHYHYQPGPFMIRPSPALFGSFRLRLAILFGGLFLASALLAAACLDQVLS
DRIVRDQGEAMNSLAANIAKAIESNLRERHREVLLLAQTPTYVRVPLDGDDVRQSLERTK
QAYKYYAWIGITDAEGKIVSAAGGMLVGQSAAKRPWFIHGRHAPFVGDIHQAVLLAKLLP
NRSPQGEPLRFVDFASPVYDPSGKLRGVLATHALWDWVEDIIRERLPARSGLETFIVDRQ
NNLLSPFEAVGRMQAPAPMPSGQTFRLGPWPGGGNYLYSESRVREAGLDWRVVIRQPRQQ
ALTALNRLRGALMLLGLAASALLMAAVYRLAASFSRPLEQLAGVAERVGRGDEQPDWEIR
GGTQELRQLSDAMRNMTATLLARERQLADVNANLEQMVADRTEQLRESNRLLVQKAAQLA
QLARNDALTGLHNRMAANEQLQEEHLRHGRSGAPYAVLLLDVDHFKRVNDTHGHDAGDRV
LRHIADILRRAARATDFVARFGGEEFLLLLPETDADGAAVLAEKIRASVEQSQAPDVGRV
TLSIGLATVVPADSQPEMAVKRADQALYRAKAAGRNRVEAAARED
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atggacaatacggcccggctcgaacatataattcactaccactaccagccagggccgttc
atgatccgcccttcccccgctttattcggcagcttccgcctgcggctggccatcctgttc
ggcggactgttcctcgcatcggcgctgctggccgcggcctgcctcgaccaggtgttgtcg
gaccgcatcgtccgggatcagggcgaggcgatgaacagcctggccgccaatatcgccaag
gccatcgaaagcaatctgcgggaacgccaccgcgaggtgctgctgctggcgcaaacgccc
acctacgtccgggtgccgctggacggcgacgatgtgcgccagagcctggagcgcaccaag
caagcctacaagtactacgcctggatcggcatcaccgacgccgaaggcaagatcgtttcc
gccgcgggcggcatgctggtcggccagagcgcggccaagcgcccgtggttcatccacggc
cggcacgcgccgttcgtcggcgacatccaccaggccgtgctgctggccaagctgctgccg
aatcgctcgccccagggcgaaccgctgcgcttcgtcgatttcgcctccccggtatacgac
ccgtccggcaagctgcgcggcgtgctcgccacccacgcgctgtgggactgggtggaagac
atcatacgcgaacggctccccgccagatccggactggaaaccttcatcgtcgaccggcag
aacaacctgctgtcgccgttcgaggccgtggggcggatgcaggcgccggcgcccatgcct
tccgggcagacgttccgcctcggcccctggcccggcggcgggaactacctgtacagcgag
tcccgggtgcgcgaggccggactggattggcgcgtggtcatccgccagcccaggcagcag
gcgctgacggcgctgaaccgcctgcgcggcgcgctgatgctgctgggcctggccgccagc
gccttgctgatggcggccgtctaccggctggccgcctctttcagccggccgctggagcaa
ctggcgggcgtcgccgagcgcgtgggccgcggcgatgagcagcccgactgggaaatacgc
ggcggcacgcaggagcttcgccagctgtcggacgcgatgcgaaacatgaccgccaccctg
ctcgcccgcgagcgccagctggccgacgtcaacgccaacctggagcaaatggtcgcggat
cgcaccgaacagctgcgcgaatccaatcgcctgctggtgcaaaaggccgcgcagctggcg
caactggcgcgcaacgacgcgctcaccggcctgcacaaccgcatggccgccaacgaacag
ctgcaggaagagcatctgcgccatggccgcagcggcgcgccgtacgcggtactgttgctg
gatgtcgatcacttcaagcgcgtcaacgacacccatggccatgacgcaggcgaccgcgtg
ctgcgccacatcgccgacatccttcggcgcgcggcccgcgccaccgatttcgtcgcgcgc
ttcggcggcgaggaattcttgctgctgctccctgaaaccgacgccgacggcgccgcggtg
ctggcggaaaaaatccgcgcgtccgtcgagcaatcccaggcccctgacgtcggccgggtc
acgctcagcataggcctggccaccgtcgtccctgccgactcccagccggaaatggcggtg
aagcgcgccgaccaggcgctgtaccgcgccaaggccgccggccgcaaccgggtggaagcc
gcggcgcgggaggactga

DBGET integrated database retrieval system