KEGG   Chromobacterium violaceum: CV_4158Help
Entry
CV_4158           CDS       T00147                                 

Definition
(GenBank) probable glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
cvi  Chromobacterium violaceum
Pathway
cvi00220  Arginine biosynthesis
cvi00250  Alanine, aspartate and glutamate metabolism
cvi00471  D-Glutamine and D-glutamate metabolism
cvi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cvi00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CV_4158
   00220 Arginine biosynthesis
    CV_4158
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    CV_4158
Enzymes [BR:cvi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     CV_4158
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: AAQ61819
LNCC_Brazil: CV4158
UniProt: Q7NQH9
Position
4500580..4501494
Genome map
AA seq 304 aa AA seqDB search
MNLQALIEDIRQQVLPFYDQGRVADYIPALASVPPHQFGIAIHTLDGREHACGDADTPFS
IQSISKAFMLALTLQADGEQLWRHVGKEPSGNPFNSLVQLEYEHGIPRNPFINAGALVVT
DRAIGHFGDAHARLLAWLREETGNAGLMADQAIAASERAHGDRNAALAHFMKSYGNLGHP
VETVLDQYFHNCSIAMSCRELARAGLFLANHGLSPQTGTQYLSRSQAKQVNAVMLTCGTY
DAAGEFAYRVGLPVKSGVGGGLLAVIPGKMAIAAWSPQLDARGNSVLGLEALDRFTTRTG
LSIF
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaatctgcaagcgctcattgaagatatccggcagcaagtgctgcctttctacgaccag
ggccgggtggccgactacatcccggcgctggcctcggtgccgccgcatcagttcggcatc
gccatccacacgctggacggccgcgaacacgcctgcggcgatgccgacactcccttctcc
atccagagcatcagcaaggccttcatgctggcgctgacgctgcaggccgacggcgagcaa
ctgtggcgccacgtcggcaaggagccttccggcaacccgttcaactcgctggtgcagctg
gagtacgagcacggcatcccgcgcaatcccttcatcaacgccggcgccctggtcgtcacc
gaccgcgcgatcggccatttcggcgatgcccacgcccggctgctggcctggctgcgcgaa
gagaccggcaacgccggcctgatggccgaccaagccatcgccgcttccgaacgcgcgcac
ggcgaccgcaacgcggcgctcgcccatttcatgaagagctacggcaacctcggccacccg
gtggaaaccgtgctggaccagtattttcacaactgcagcatcgcgatgagctgccgcgaa
ctggcccgcgccggcctgttcctagccaatcacggcctgtcgcctcaaaccggaacacag
tacctgagccgcagccaggccaaacaggtgaacgccgtcatgctgacctgcggcacctat
gacgccgccggcgaattcgcctaccgcgtcggcctgccggtgaagagcggcgtcggcggc
ggcctgctggcggtgattcccggcaagatggccatcgccgcgtggagcccgcaactggac
gcgcgcggcaactcggtgctgggcctggaggcgttggatcgcttcaccacgcgcaccggg
ctctccatcttctag

DBGET integrated database retrieval system