KEGG   Chromobacterium violaceum: CV_4278Help
Entry
CV_4278           CDS       T00147                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
cvi  Chromobacterium violaceum
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:cvi00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CV_4278
Enzymes [BR:cvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     CV_4278
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
LNCC_Brazil: 
UniProt: 
Position
complement(4612919..4613863)
Genome map
AA seq 314 aa AA seqDB search
MSILVCGALAYDTLFSFHGRFDSQILPDQLHKISTTFLAPTMRREFGGMAGNIAYSLCLL
GEKPIVMGVVGEDFEPYRQHLKRVGVDDRFIRLIRKQYTPQCFGIADKDGNQLMAFHPGA
MDFATENHVSDIQDPIELAILSPGGYTAFIQHSRELAAAGIPFIFDPGQELPLLSSDEIH
EIVELASYVAINDYESELMRERAGLTVDDLRKKVKALIVTRGSKGAEIYVDDTVHLIPRV
QMPIKPVDPMGCGDAFRAGLLWGISRGVDWKVTGRLANVIGAIKVTTPGCQNHFFDWDSL
KDIYFKAYGEEWPL
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgtctatcctcgtctgcggggcgctcgcatacgataccctgttctcgttccatggccga
ttcgacagccagatcctgccggatcagctgcacaagatctcgaccaccttcctcgctccg
acgatgcgccgcgaattcggcggcatggccggcaacatcgcctacagcctgtgcctgctg
ggcgaaaagcccatcgtgatgggcgtggtcggcgaggacttcgagccttaccgccagcac
ctgaaacgggtgggcgtggacgaccgcttcatccgcctgatccgcaagcagtataccccg
caatgcttcggcattgccgacaaggacggcaaccagctgatggccttccatccgggcgcg
atggatttcgccaccgagaaccacgtgtccgacatccaggacccgatcgagctggccatc
ctgtcgccgggcggctacaccgccttcatccagcactcgcgcgagctggcggccgcgggc
atccccttcattttcgatccgggccaggagctgccgctgctgtccagcgacgagatccac
gagatcgtcgagctggccagctacgtggcgatcaacgactacgagagcgagctgatgcgc
gagcgcgccggcctgaccgtggacgacctgcgcaagaaggtgaaggcgctgatcgtcacc
cgcggctccaagggcgccgagatctacgtcgacgacaccgtgcacctgattccgcgcgtg
cagatgcccatcaagccggtggacccgatgggctgcggcgacgcgttccgcgccggcctg
ctgtggggcatcagccgcggcgtggactggaaggtcaccggccggttggccaatgtgatc
ggcgcgatcaaggtcaccacgccgggttgccagaaccacttcttcgactgggactcgctg
aaggacatctatttcaaggcctatggcgaggaatggccgttgtaa

DBGET integrated database retrieval system