KEGG   Chromobacterium violaceum: CV_4282Help
Entry
CV_4282           CDS       T00147                                 

Gene name
phoD
Definition
phosphodiesterase I (EC:3.1.4.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
cvi  Chromobacterium violaceum
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cvi00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:cvi00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:cvi02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
LNCC_Brazil: 
UniProt: 
Position
4618245..4620350
Genome map
AA seq 701 aa AA seqDB search
MSRDNPQPCAFLQQTTVSGETMDRRQFLKWGSFLTVSVAAVGCGGGGGDSAGAAGQRLQA
AGQGFGLGVASGDPRPDSIILWTRVDGGDGANPLSVTVQLSDKADFSSLLVNQALSADPG
WDYTVRHKVTGLSSATTYYYRFLTGKTVSAAGRTKTAPAAGTPLSQLKFAYITCQDWSVN
HWGAFDEIAKLDLDFVMHVGDYIYETVGAGFQTGNNETRHPPLTLPNGTKRADGAIYATT
LADYRYLYKSYRADPRIQAVHANFPVISIWDDHEFSDDCWQDRQVYYPGDDSAPSTPRRR
SANQAWFEYTPADVSIDLANPSFQNIQIYRSFAFGNLATLVMTDQRLYRSDHIIPETAAP
NTGLANLGSRYFVPKTTLAQAEAAKMASTGGNLLNVSILGAVQRAWWQQQMQSAATTWKL
WGNEVSLLRMGVDGTMAVASLLEQGLSSALAQGFGLNLGAAQQQQLTGALYQDLLAADTS
GATPVLSYANTQPLLAGFSGGAISAGVFAAAVKPSLDGNLPPSMLLAQYILNADQWDGYN
AERKTLMAFLKSNNIGNVVGITGDIHAFFAGPVMDDFDAASPTPVMVDLVTAGISSNSFF
SYFKNVVDTVPAFAKAAPLIYQTVNGQTVNTFNSTLKTFNPWLKYADTDAQGYAVVTLTP
GKLSCTFHKMAKLANGVAPSPATASTQTVEVLAGAPAVNVL
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
ttgagccgcgataatccgcaaccttgtgcattcctacaacaaacgacagtctctggagaa
acgatggatagacggcaattcctcaagtggggcagtttcctgacggtatcggtggcggcg
gtgggctgcggcggcggaggcggcgacagcgccggcgcggcagggcagcgcctgcaggcg
gcgggacagggcttcggcctgggcgtggcctcgggcgatccgcgcccggacagcatcatc
ctgtggacacgcgtcgacggcggcgacggcgccaatccgctgtcggtcaccgtgcagctg
tcggacaaggcggacttctccagcctgctagtcaaccaggcgctcagcgccgatccgggc
tgggactacaccgtgcgccacaaggtgaccggcctgtccagcgccaccacttattactac
cgcttcctgaccggcaagaccgtcagcgccgcaggccgcaccaaaaccgcgccggccgcc
ggcacgccgctgtcccaactcaagttcgcctacatcacctgccaggactggagcgtcaac
cactggggcgccttcgacgagatcgccaagctggacctggacttcgtgatgcacgtcggc
gattacatctacgaaaccgtcggcgccggcttccagaccggcaacaacgaaacccggcac
ccgccgctgacgctgcccaacggcaccaagcgcgccgacggcgccatctacgccaccacg
ctggccgactaccgctacctgtacaagagctaccgcgccgacccgcgcatccaggcggtg
cacgccaacttcccggtgatctcgatctgggacgaccacgagttctccgacgactgctgg
caggaccgtcaggtgtactaccccggcgacgacagcgcgcccagcacgccgcgccgccgc
agcgccaaccaggcctggttcgaatacacgccggccgatgtcagcatcgatctggcgaac
ccctcgttccagaacatccagatctaccgcagcttcgccttcggcaacctggccacgctg
gtgatgaccgaccagcgcctgtaccgctccgaccacatcatcccggaaaccgccgcgccg
aacaccggcctggccaacctgggcagccgctacttcgtgcccaaaaccacgctggcccag
gccgaggccgccaagatggcgtccaccggcggcaatctgctcaacgtgtccatcctcggc
gccgtccagcgcgcctggtggcagcagcagatgcaaagcgccgccaccacctggaagctg
tggggcaacgaggtgtccctgctcaggatgggcgtggacggcaccatggcggtggccagc
ctgctggagcagggcttgtcgtccgcgctggcgcagggcttcggcctcaacctcggcgcc
gcccagcagcaacagctgaccggcgcgctgtaccaggacctgctggccgccgacaccagt
ggcgcgaccccggtgctgagctatgccaacacccagccgctgctggccggcttcagcggc
ggcgcgatcagcgccggcgtgttcgccgccgcggtgaagccttcgcttgacggcaacctg
ccgccgagcatgctgctcgcccagtacatcctcaacgccgaccagtgggacggctacaac
gccgagcgcaagacgctgatggccttcctgaaaagcaacaacatcggcaacgtggtgggc
atcaccggcgacatccacgccttcttcgccggccccgtgatggacgacttcgacgccgcc
agcccgacgccggtgatggtggatctggtgaccgccggcatctccagcaactccttcttc
agctatttcaagaacgtggtggacaccgtgccggccttcgccaaggccgcgccgctgatc
taccagacggtgaacggccagacggtcaacaccttcaacagcacgctgaaaaccttcaac
ccgtggctgaagtacgccgacactgacgcccaaggctacgcggtggtgacgctgacgccg
ggcaagctcagctgcaccttccacaagatggccaagctggcgaacggcgtcgcgccgtcg
ccggccaccgccagcacccagacggtggaagtgctggccggcgcgccggccgtcaacgtg
ctgtag

DBGET integrated database retrieval system